diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/Constants.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/Constants.java deleted file mode 100644 index 6fbf52e8d..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/Constants.java +++ /dev/null @@ -1,208 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper; - - -/** - * Some constants and other global data that are used by the compiler and the runtime. - * - * @author Anil K. Vijendran - * @author Harish Prabandham - * @author Shawn Bayern - * @author Mark Roth - */ -public class Constants { - - /** - * The base class of the generated servlets. - */ - public static final String JSP_SERVLET_BASE = - System.getProperty("org.apache.jasper.Constants.JSP_SERVLET_BASE", "org.apache.jasper.runtime.HttpJspBase"); - - /** - * _jspService is the name of the method that is called by - * HttpJspBase.service(). This is where most of the code generated - * from JSPs go. - */ - public static final String SERVICE_METHOD_NAME = - System.getProperty("org.apache.jasper.Constants.SERVICE_METHOD_NAME", "_jspService"); - - /** - * Default servlet content type. - */ - public static final String SERVLET_CONTENT_TYPE = "text/html"; - - /** - * These classes/packages are automatically imported by the - * generated code. - */ - public static final String[] STANDARD_IMPORTS = { - "javax.servlet.*", - "javax.servlet.http.*", - "javax.servlet.jsp.*" - }; - - /** - * ServletContext attribute for classpath. This is tomcat specific. - * Other servlet engines may choose to support this attribute if they - * want to have this JSP engine running on them. - */ - public static final String SERVLET_CLASSPATH = - System.getProperty("org.apache.jasper.Constants.SERVLET_CLASSPATH", "org.apache.catalina.jsp_classpath"); - - /** - * Request attribute for <jsp-file> element of a - * servlet definition. If present on a request, this overrides the - * value returned by request.getServletPath() to select - * the JSP page to be executed. - */ - public static final String JSP_FILE = - System.getProperty("org.apache.jasper.Constants.JSP_FILE", "org.apache.catalina.jsp_file"); - - - /** - * Default size of the JSP buffer. - */ - public static final int DEFAULT_BUFFER_SIZE = 8 * 1024; - - /** - * Default size for the tag buffers. - */ - public static final int DEFAULT_TAG_BUFFER_SIZE = 512; - - /** - * Default tag handler pool size. - */ - public static final int MAX_POOL_SIZE = 5; - - /** - * The query parameter that causes the JSP engine to just - * pregenerated the servlet but not invoke it. - */ - public static final String PRECOMPILE = - System.getProperty("org.apache.jasper.Constants.PRECOMPILE", "jsp_precompile"); - - /** - * The default package name for compiled jsp pages. - */ - public static final String JSP_PACKAGE_NAME = - System.getProperty("org.apache.jasper.Constants.JSP_PACKAGE_NAME", "org.apache.jsp"); - - /** - * The default package name for tag handlers generated from tag files - */ - public static final String TAG_FILE_PACKAGE_NAME = - System.getProperty("org.apache.jasper.Constants.TAG_FILE_PACKAGE_NAME", "org.apache.jsp.tag"); - - /** - * Servlet context and request attributes that the JSP engine - * uses. - */ - public static final String INC_SERVLET_PATH = "javax.servlet.include.servlet_path"; - public static final String TMP_DIR = "javax.servlet.context.tempdir"; - - // Must be kept in sync with org/apache/catalina/Globals.java - public static final String ALT_DD_ATTR = - System.getProperty("org.apache.jasper.Constants.ALT_DD_ATTR", "org.apache.catalina.deploy.alt_dd"); - - /** - * Public Id and the Resource path (of the cached copy) - * of the DTDs for tag library descriptors. - */ - public static final String TAGLIB_DTD_PUBLIC_ID_11 = - "-//Sun Microsystems, Inc.//DTD JSP Tag Library 1.1//EN"; - public static final String TAGLIB_DTD_RESOURCE_PATH_11 = - "/javax/servlet/jsp/resources/web-jsptaglibrary_1_1.dtd"; - public static final String TAGLIB_DTD_PUBLIC_ID_12 = - "-//Sun Microsystems, Inc.//DTD JSP Tag Library 1.2//EN"; - public static final String TAGLIB_DTD_RESOURCE_PATH_12 = - "/javax/servlet/jsp/resources/web-jsptaglibrary_1_2.dtd"; - - /** - * Public Id and the Resource path (of the cached copy) - * of the DTDs for web application deployment descriptors - */ - public static final String WEBAPP_DTD_PUBLIC_ID_22 = - "-//Sun Microsystems, Inc.//DTD Web Application 2.2//EN"; - public static final String WEBAPP_DTD_RESOURCE_PATH_22 = - "/javax/servlet/resources/web-app_2_2.dtd"; - public static final String WEBAPP_DTD_PUBLIC_ID_23 = - "-//Sun Microsystems, Inc.//DTD Web Application 2.3//EN"; - public static final String WEBAPP_DTD_RESOURCE_PATH_23 = - "/javax/servlet/resources/web-app_2_3.dtd"; - - /** - * List of the Public IDs that we cache, and their - * associated location. This is used by - * an EntityResolver to return the location of the - * cached copy of a DTD. - */ - public static final String[] CACHED_DTD_PUBLIC_IDS = { - TAGLIB_DTD_PUBLIC_ID_11, - TAGLIB_DTD_PUBLIC_ID_12, - WEBAPP_DTD_PUBLIC_ID_22, - WEBAPP_DTD_PUBLIC_ID_23, - }; - public static final String[] CACHED_DTD_RESOURCE_PATHS = { - TAGLIB_DTD_RESOURCE_PATH_11, - TAGLIB_DTD_RESOURCE_PATH_12, - WEBAPP_DTD_RESOURCE_PATH_22, - WEBAPP_DTD_RESOURCE_PATH_23, - }; - - /** - * Default URLs to download the pluging for Netscape and IE. - */ - public static final String NS_PLUGIN_URL = - "http://java.sun.com/products/plugin/"; - - public static final String IE_PLUGIN_URL = - "http://java.sun.com/products/plugin/1.2.2/jinstall-1_2_2-win.cab#Version=1,2,2,0"; - - /** - * Prefix to use for generated temporary variable names - */ - public static final String TEMP_VARIABLE_NAME_PREFIX = - System.getProperty("org.apache.jasper.Constants.TEMP_VARIABLE_NAME_PREFIX", "_jspx_temp"); - - /** - * A replacement char for "\$". - * XXX This is a hack to avoid changing EL interpreter to recognize "\$" - * @deprecated - */ - public static final char ESC = '\u001b'; - /** - * @deprecated - */ - public static final String ESCStr = "'\\u001b'"; - - /** - * Has security been turned on? - */ - public static final boolean IS_SECURITY_ENABLED = - (System.getSecurityManager() != null); - - /** - * The name of the path parameter used to pass the session identifier - * back and forth with the client. - */ - public static final String SESSION_PARAMETER_NAME = - System.getProperty("org.apache.catalina.SESSION_PARAMETER_NAME", - "jsessionid"); - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/EmbeddedServletOptions.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/EmbeddedServletOptions.java deleted file mode 100644 index 17ec10891..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/EmbeddedServletOptions.java +++ /dev/null @@ -1,673 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper; - -import java.io.File; -import java.util.*; - -import javax.servlet.ServletConfig; -import javax.servlet.ServletContext; - -import org.apache.jasper.compiler.TldLocationsCache; -import org.apache.jasper.compiler.JspConfig; -import org.apache.jasper.compiler.TagPluginManager; -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.xmlparser.ParserUtils; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * A class to hold all init parameters specific to the JSP engine. - * - * @author Anil K. Vijendran - * @author Hans Bergsten - * @author Pierre Delisle - */ -public final class EmbeddedServletOptions implements Options { - - // Logger - private Log log = LogFactory.getLog(EmbeddedServletOptions.class); - - private Properties settings = new Properties(); - - /** - * Is Jasper being used in development mode? - */ - private boolean development = true; - - /** - * Should Ant fork its java compiles of JSP pages. - */ - public boolean fork = true; - - /** - * Do you want to keep the generated Java files around? - */ - private boolean keepGenerated = true; - - /** - * Should white spaces between directives or actions be trimmed? - */ - private boolean trimSpaces = false; - - /** - * Determines whether tag handler pooling is enabled. - */ - private boolean isPoolingEnabled = true; - - /** - * Do you want support for "mapped" files? This will generate - * servlet that has a print statement per line of the JSP file. - * This seems like a really nice feature to have for debugging. - */ - private boolean mappedFile = true; - - /** - * Do we want to include debugging information in the class file? - */ - private boolean classDebugInfo = true; - - /** - * Background compile thread check interval in seconds. - */ - private int checkInterval = 0; - - /** - * Is the generation of SMAP info for JSR45 debuggin suppressed? - */ - private boolean isSmapSuppressed = false; - - /** - * Should SMAP info for JSR45 debugging be dumped to a file? - */ - private boolean isSmapDumped = false; - - /** - * Are Text strings to be generated as char arrays? - */ - private boolean genStringAsCharArray = false; - - private boolean errorOnUseBeanInvalidClassAttribute = true; - - /** - * I want to see my generated servlets. Which directory are they - * in? - */ - private File scratchDir; - - /** - * Need to have this as is for versions 4 and 5 of IE. Can be set from - * the initParams so if it changes in the future all that is needed is - * to have a jsp initParam of type ieClassId="" - */ - private String ieClassId = "clsid:8AD9C840-044E-11D1-B3E9-00805F499D93"; - - /** - * What classpath should I use while compiling generated servlets? - */ - private String classpath = null; - - /** - * Compiler to use. - */ - private String compiler = null; - - /** - * Compiler target VM. - */ - private String compilerTargetVM = "1.5"; - - /** - * The compiler source VM. - */ - private String compilerSourceVM = "1.5"; - - /** - * The compiler class name. - */ - private String compilerClassName = null; - - /** - * Cache for the TLD locations - */ - private TldLocationsCache tldLocationsCache = null; - - /** - * Jsp config information - */ - private JspConfig jspConfig = null; - - /** - * TagPluginManager - */ - private TagPluginManager tagPluginManager = null; - - /** - * Java platform encoding to generate the JSP - * page servlet. - */ - private String javaEncoding = "UTF8"; - - /** - * Modification test interval. - */ - private int modificationTestInterval = 4; - - /** - * Is generation of X-Powered-By response header enabled/disabled? - */ - private boolean xpoweredBy; - - /** - * Should we include a source fragment in exception messages, which could be displayed - * to the developer ? - */ - private boolean displaySourceFragment = true; - - - public String getProperty(String name ) { - return settings.getProperty( name ); - } - - public void setProperty(String name, String value ) { - if (name != null && value != null){ - settings.setProperty( name, value ); - } - } - - /** - * Are we keeping generated code around? - */ - public boolean getKeepGenerated() { - return keepGenerated; - } - - /** - * Should white spaces between directives or actions be trimmed? - */ - public boolean getTrimSpaces() { - return trimSpaces; - } - - public boolean isPoolingEnabled() { - return isPoolingEnabled; - } - - /** - * Are we supporting HTML mapped servlets? - */ - public boolean getMappedFile() { - return mappedFile; - } - - /** - * Should errors be sent to client or thrown into stderr? - * @deprecated - */ - @Deprecated - public boolean getSendErrorToClient() { - return true; - } - - /** - * Should class files be compiled with debug information? - */ - public boolean getClassDebugInfo() { - return classDebugInfo; - } - - /** - * Background JSP compile thread check intervall - */ - public int getCheckInterval() { - return checkInterval; - } - - /** - * Modification test interval. - */ - public int getModificationTestInterval() { - return modificationTestInterval; - } - - /** - * Is Jasper being used in development mode? - */ - public boolean getDevelopment() { - return development; - } - - /** - * Is the generation of SMAP info for JSR45 debuggin suppressed? - */ - public boolean isSmapSuppressed() { - return isSmapSuppressed; - } - - /** - * Should SMAP info for JSR45 debugging be dumped to a file? - */ - public boolean isSmapDumped() { - return isSmapDumped; - } - - /** - * Are Text strings to be generated as char arrays? - */ - public boolean genStringAsCharArray() { - return this.genStringAsCharArray; - } - - /** - * Class ID for use in the plugin tag when the browser is IE. - */ - public String getIeClassId() { - return ieClassId; - } - - /** - * What is my scratch dir? - */ - public File getScratchDir() { - return scratchDir; - } - - /** - * What classpath should I use while compiling the servlets - * generated from JSP files? - */ - public String getClassPath() { - return classpath; - } - - /** - * Is generation of X-Powered-By response header enabled/disabled? - */ - public boolean isXpoweredBy() { - return xpoweredBy; - } - - /** - * Compiler to use. - */ - public String getCompiler() { - return compiler; - } - - /** - * @see Options#getCompilerTargetVM - */ - public String getCompilerTargetVM() { - return compilerTargetVM; - } - - /** - * @see Options#getCompilerSourceVM - */ - public String getCompilerSourceVM() { - return compilerSourceVM; - } - - /** - * Java compiler class to use. - */ - public String getCompilerClassName() { - return compilerClassName; - } - - public boolean getErrorOnUseBeanInvalidClassAttribute() { - return errorOnUseBeanInvalidClassAttribute; - } - - public void setErrorOnUseBeanInvalidClassAttribute(boolean b) { - errorOnUseBeanInvalidClassAttribute = b; - } - - public TldLocationsCache getTldLocationsCache() { - return tldLocationsCache; - } - - public void setTldLocationsCache( TldLocationsCache tldC ) { - tldLocationsCache = tldC; - } - - public String getJavaEncoding() { - return javaEncoding; - } - - public boolean getFork() { - return fork; - } - - public JspConfig getJspConfig() { - return jspConfig; - } - - public TagPluginManager getTagPluginManager() { - return tagPluginManager; - } - - public boolean isCaching() { - return false; - } - - public Map getCache() { - return null; - } - - /** - * Should we include a source fragment in exception messages, which could be displayed - * to the developer ? - */ - public boolean getDisplaySourceFragment() { - return displaySourceFragment; - } - - /** - * Create an EmbeddedServletOptions object using data available from - * ServletConfig and ServletContext. - */ - public EmbeddedServletOptions(ServletConfig config, - ServletContext context) { - - // JVM version numbers - try { - if (Float.parseFloat(System.getProperty("java.specification.version")) > 1.4) { - compilerSourceVM = compilerTargetVM = "1.5"; - } else { - compilerSourceVM = compilerTargetVM = "1.4"; - } - } catch (NumberFormatException e) { - // Ignore - } - - Enumeration enumeration=config.getInitParameterNames(); - while( enumeration.hasMoreElements() ) { - String k=(String)enumeration.nextElement(); - String v=config.getInitParameter( k ); - setProperty( k, v); - } - - // quick hack - String validating=config.getInitParameter( "validating"); - if( "false".equals( validating )) ParserUtils.validating=false; - - String keepgen = config.getInitParameter("keepgenerated"); - if (keepgen != null) { - if (keepgen.equalsIgnoreCase("true")) { - this.keepGenerated = true; - } else if (keepgen.equalsIgnoreCase("false")) { - this.keepGenerated = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.keepgen")); - } - } - } - - - String trimsp = config.getInitParameter("trimSpaces"); - if (trimsp != null) { - if (trimsp.equalsIgnoreCase("true")) { - trimSpaces = true; - } else if (trimsp.equalsIgnoreCase("false")) { - trimSpaces = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.trimspaces")); - } - } - } - - this.isPoolingEnabled = true; - String poolingEnabledParam - = config.getInitParameter("enablePooling"); - if (poolingEnabledParam != null - && !poolingEnabledParam.equalsIgnoreCase("true")) { - if (poolingEnabledParam.equalsIgnoreCase("false")) { - this.isPoolingEnabled = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.enablePooling")); - } - } - } - - String mapFile = config.getInitParameter("mappedfile"); - if (mapFile != null) { - if (mapFile.equalsIgnoreCase("true")) { - this.mappedFile = true; - } else if (mapFile.equalsIgnoreCase("false")) { - this.mappedFile = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.mappedFile")); - } - } - } - - String debugInfo = config.getInitParameter("classdebuginfo"); - if (debugInfo != null) { - if (debugInfo.equalsIgnoreCase("true")) { - this.classDebugInfo = true; - } else if (debugInfo.equalsIgnoreCase("false")) { - this.classDebugInfo = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.classDebugInfo")); - } - } - } - - String checkInterval = config.getInitParameter("checkInterval"); - if (checkInterval != null) { - try { - this.checkInterval = Integer.parseInt(checkInterval); - } catch(NumberFormatException ex) { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.checkInterval")); - } - } - } - - String modificationTestInterval = config.getInitParameter("modificationTestInterval"); - if (modificationTestInterval != null) { - try { - this.modificationTestInterval = Integer.parseInt(modificationTestInterval); - } catch(NumberFormatException ex) { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.modificationTestInterval")); - } - } - } - - String development = config.getInitParameter("development"); - if (development != null) { - if (development.equalsIgnoreCase("true")) { - this.development = true; - } else if (development.equalsIgnoreCase("false")) { - this.development = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.development")); - } - } - } - - String suppressSmap = config.getInitParameter("suppressSmap"); - if (suppressSmap != null) { - if (suppressSmap.equalsIgnoreCase("true")) { - isSmapSuppressed = true; - } else if (suppressSmap.equalsIgnoreCase("false")) { - isSmapSuppressed = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.suppressSmap")); - } - } - } - - String dumpSmap = config.getInitParameter("dumpSmap"); - if (dumpSmap != null) { - if (dumpSmap.equalsIgnoreCase("true")) { - isSmapDumped = true; - } else if (dumpSmap.equalsIgnoreCase("false")) { - isSmapDumped = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.dumpSmap")); - } - } - } - - String genCharArray = config.getInitParameter("genStrAsCharArray"); - if (genCharArray != null) { - if (genCharArray.equalsIgnoreCase("true")) { - genStringAsCharArray = true; - } else if (genCharArray.equalsIgnoreCase("false")) { - genStringAsCharArray = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.genchararray")); - } - } - } - - String errBeanClass = - config.getInitParameter("errorOnUseBeanInvalidClassAttribute"); - if (errBeanClass != null) { - if (errBeanClass.equalsIgnoreCase("true")) { - errorOnUseBeanInvalidClassAttribute = true; - } else if (errBeanClass.equalsIgnoreCase("false")) { - errorOnUseBeanInvalidClassAttribute = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.errBean")); - } - } - } - - String ieClassId = config.getInitParameter("ieClassId"); - if (ieClassId != null) - this.ieClassId = ieClassId; - - String classpath = config.getInitParameter("classpath"); - if (classpath != null) - this.classpath = classpath; - - /* - * scratchdir - */ - String dir = config.getInitParameter("scratchdir"); - if (dir != null) { - scratchDir = new File(dir); - } else { - // First try the Servlet 2.2 javax.servlet.context.tempdir property - scratchDir = (File) context.getAttribute(Constants.TMP_DIR); - if (scratchDir == null) { - // Not running in a Servlet 2.2 container. - // Try to get the JDK 1.2 java.io.tmpdir property - dir = System.getProperty("java.io.tmpdir"); - if (dir != null) - scratchDir = new File(dir); - } - } - if (this.scratchDir == null) { - log.fatal(Localizer.getMessage("jsp.error.no.scratch.dir")); - return; - } - - if (!(scratchDir.exists() && scratchDir.canRead() && - scratchDir.canWrite() && scratchDir.isDirectory())) - log.fatal(Localizer.getMessage("jsp.error.bad.scratch.dir", - scratchDir.getAbsolutePath())); - - this.compiler = config.getInitParameter("compiler"); - - String compilerTargetVM = config.getInitParameter("compilerTargetVM"); - if(compilerTargetVM != null) { - this.compilerTargetVM = compilerTargetVM; - } - - String compilerSourceVM = config.getInitParameter("compilerSourceVM"); - if(compilerSourceVM != null) { - this.compilerSourceVM = compilerSourceVM; - } - - String javaEncoding = config.getInitParameter("javaEncoding"); - if (javaEncoding != null) { - this.javaEncoding = javaEncoding; - } - - String compilerClassName = config.getInitParameter("compilerClassName"); - if (compilerClassName != null) { - this.compilerClassName = compilerClassName; - } - - String fork = config.getInitParameter("fork"); - if (fork != null) { - if (fork.equalsIgnoreCase("true")) { - this.fork = true; - } else if (fork.equalsIgnoreCase("false")) { - this.fork = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.fork")); - } - } - } - - String xpoweredBy = config.getInitParameter("xpoweredBy"); - if (xpoweredBy != null) { - if (xpoweredBy.equalsIgnoreCase("true")) { - this.xpoweredBy = true; - } else if (xpoweredBy.equalsIgnoreCase("false")) { - this.xpoweredBy = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.xpoweredBy")); - } - } - } - - String displaySourceFragment = config.getInitParameter("displaySourceFragment"); - if (displaySourceFragment != null) { - if (displaySourceFragment.equalsIgnoreCase("true")) { - this.displaySourceFragment = true; - } else if (displaySourceFragment.equalsIgnoreCase("false")) { - this.displaySourceFragment = false; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jsp.warning.displaySourceFragment")); - } - } - } - - // Setup the global Tag Libraries location cache for this - // web-application. - tldLocationsCache = new TldLocationsCache(context); - - // Setup the jsp config info for this web app. - jspConfig = new JspConfig(context); - - // Create a Tag plugin instance - tagPluginManager = new TagPluginManager(context); - } - -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JasperException.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JasperException.java deleted file mode 100644 index cc06a2bf2..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JasperException.java +++ /dev/null @@ -1,46 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper; - -/** - * Base class for all exceptions generated by the JSP engine. Makes it - * convienient to catch just this at the top-level. - * - * @author Anil K. Vijendran - */ -public class JasperException extends javax.servlet.ServletException { - - public JasperException(String reason) { - super(reason); - } - - /** - * Creates a JasperException with the embedded exception and the reason for - * throwing a JasperException - */ - public JasperException (String reason, Throwable exception) { - super(reason, exception); - } - - /** - * Creates a JasperException with the embedded exception - */ - public JasperException (Throwable exception) { - super(exception); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JspC.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JspC.java deleted file mode 100644 index e7e9dfd28..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JspC.java +++ /dev/null @@ -1,1424 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper; - -import java.io.BufferedReader; -import java.io.CharArrayWriter; -import java.io.File; -import java.io.FileInputStream; -import java.io.FileNotFoundException; -import java.io.FileOutputStream; -import java.io.FileReader; -import java.io.FileWriter; -import java.io.IOException; -import java.io.PrintWriter; -import java.io.Writer; -import java.net.MalformedURLException; -import java.net.URL; -import java.net.URLClassLoader; -import java.util.ArrayList; -import java.util.Iterator; -import java.util.List; -import java.util.Map; -import java.util.HashMap; -import java.util.Stack; -import java.util.StringTokenizer; -import java.util.Vector; - -import org.apache.jasper.compiler.Compiler; -import org.apache.jasper.compiler.JspConfig; -import org.apache.jasper.compiler.JspRuntimeContext; -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.compiler.TagPluginManager; -import org.apache.jasper.compiler.TldLocationsCache; -import org.apache.jasper.servlet.JspCServletContext; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -import org.apache.tools.ant.AntClassLoader; -import org.apache.tools.ant.Project; -import org.apache.tools.ant.util.FileUtils; - -/** - * Shell for the jspc compiler. Handles all options associated with the - * command line and creates compilation contexts which it then compiles - * according to the specified options. - * - * This version can process files from a _single_ webapp at once, i.e. - * a single docbase can be specified. - * - * It can be used as an Ant task using: - * 
- *   <taskdef classname="org.apache.jasper.JspC" name="jasper2" >
- *      <classpath>
- *          <pathelement location="${java.home}/../lib/tools.jar"/>
- *          <fileset dir="${ENV.CATALINA_HOME}/server/lib">
- *              <include name="*.jar"/>
- *          </fileset>
- *          <fileset dir="${ENV.CATALINA_HOME}/common/lib">
- *              <include name="*.jar"/>
- *          </fileset>
- *          <path refid="myjars"/>
- *       </classpath>
- *  </taskdef>
- *
- *  <jasper2 verbose="0"
- *           package="my.package"
- *           uriroot="${webapps.dir}/${webapp.name}"
- *           webXmlFragment="${build.dir}/generated_web.xml"
- *           outputDir="${webapp.dir}/${webapp.name}/WEB-INF/src/my/package" />
- *
- * - * @author Danno Ferrin - * @author Pierre Delisle - * @author Costin Manolache - * @author Yoav Shapira - */ -public class JspC implements Options { - - public static final String DEFAULT_IE_CLASS_ID = - "clsid:8AD9C840-044E-11D1-B3E9-00805F499D93"; - - // Logger - protected static Log log = LogFactory.getLog(JspC.class); - - protected static final String SWITCH_VERBOSE = "-v"; - protected static final String SWITCH_HELP = "-help"; - protected static final String SWITCH_OUTPUT_DIR = "-d"; - protected static final String SWITCH_PACKAGE_NAME = "-p"; - protected static final String SWITCH_CACHE = "-cache"; - protected static final String SWITCH_CLASS_NAME = "-c"; - protected static final String SWITCH_FULL_STOP = "--"; - protected static final String SWITCH_COMPILE = "-compile"; - protected static final String SWITCH_SOURCE = "-source"; - protected static final String SWITCH_TARGET = "-target"; - protected static final String SWITCH_URI_BASE = "-uribase"; - protected static final String SWITCH_URI_ROOT = "-uriroot"; - protected static final String SWITCH_FILE_WEBAPP = "-webapp"; - protected static final String SWITCH_WEBAPP_INC = "-webinc"; - protected static final String SWITCH_WEBAPP_XML = "-webxml"; - protected static final String SWITCH_MAPPED = "-mapped"; - protected static final String SWITCH_XPOWERED_BY = "-xpoweredBy"; - protected static final String SWITCH_TRIM_SPACES = "-trimSpaces"; - protected static final String SWITCH_CLASSPATH = "-classpath"; - protected static final String SWITCH_DIE = "-die"; - protected static final String SWITCH_POOLING = "-poolingEnabled"; - protected static final String SWITCH_ENCODING = "-javaEncoding"; - protected static final String SWITCH_SMAP = "-smap"; - protected static final String SWITCH_DUMP_SMAP = "-dumpsmap"; - - protected static final String SHOW_SUCCESS ="-s"; - protected static final String LIST_ERRORS = "-l"; - protected static final int INC_WEBXML = 10; - protected static final int ALL_WEBXML = 20; - protected static final int DEFAULT_DIE_LEVEL = 1; - protected static final int NO_DIE_LEVEL = 0; - - protected static final String[] insertBefore = - { "", "", "", - "", "", "", "", - "", "", "", - "", "", "", "", - "" }; - - protected static int die; - protected String classPath = null; - protected URLClassLoader loader = null; - protected boolean trimSpaces = false; - protected boolean genStringAsCharArray = false; - protected boolean xpoweredBy; - protected boolean mappedFile = false; - protected boolean poolingEnabled = true; - protected File scratchDir; - protected String ieClassId = DEFAULT_IE_CLASS_ID; - protected String targetPackage; - protected String targetClassName; - protected String uriBase; - protected String uriRoot; - protected Project project; - protected int dieLevel; - protected boolean helpNeeded = false; - protected boolean compile = false; - protected boolean smapSuppressed = true; - protected boolean smapDumped = false; - protected boolean caching = true; - protected Map cache = new HashMap(); - - protected String compiler = null; - - protected String compilerTargetVM = "1.4"; - protected String compilerSourceVM = "1.4"; - - protected boolean classDebugInfo = true; - - /** - * Throw an exception if there's a compilation error, or swallow it. - * Default is true to preserve old behavior. - */ - protected boolean failOnError = true; - - /** - * The file extensions to be handled as JSP files. - * Default list is .jsp and .jspx. - */ - protected List extensions; - - /** - * The pages. - */ - protected List pages = new Vector(); - - /** - * Needs better documentation, this data member does. - * True by default. - */ - protected boolean errorOnUseBeanInvalidClassAttribute = true; - - /** - * The java file encoding. Default - * is UTF-8. Added per bugzilla 19622. - */ - protected String javaEncoding = "UTF-8"; - - // Generation of web.xml fragments - protected String webxmlFile; - protected int webxmlLevel; - protected boolean addWebXmlMappings = false; - - protected Writer mapout; - protected CharArrayWriter servletout; - protected CharArrayWriter mappingout; - - /** - * The servlet context. - */ - protected JspCServletContext context; - - /** - * The runtime context. - * Maintain a dummy JspRuntimeContext for compiling tag files. - */ - protected JspRuntimeContext rctxt; - - /** - * Cache for the TLD locations - */ - protected TldLocationsCache tldLocationsCache = null; - - protected JspConfig jspConfig = null; - protected TagPluginManager tagPluginManager = null; - - protected boolean verbose = false; - protected boolean listErrors = false; - protected boolean showSuccess = false; - protected int argPos; - protected boolean fullstop = false; - protected String args[]; - - public static void main(String arg[]) { - if (arg.length == 0) { - System.out.println(Localizer.getMessage("jspc.usage")); - } else { - try { - JspC jspc = new JspC(); - jspc.setArgs(arg); - if (jspc.helpNeeded) { - System.out.println(Localizer.getMessage("jspc.usage")); - } else { - jspc.execute(); - } - } catch (JasperException je) { - System.err.println(je); - if (die != NO_DIE_LEVEL) { - System.exit(die); - } - } - } - } - - public void setArgs(String[] arg) throws JasperException { - args = arg; - String tok; - - dieLevel = NO_DIE_LEVEL; - die = dieLevel; - - while ((tok = nextArg()) != null) { - if (tok.equals(SWITCH_VERBOSE)) { - verbose = true; - showSuccess = true; - listErrors = true; - } else if (tok.equals(SWITCH_OUTPUT_DIR)) { - tok = nextArg(); - setOutputDir( tok ); - } else if (tok.equals(SWITCH_PACKAGE_NAME)) { - targetPackage = nextArg(); - } else if (tok.equals(SWITCH_COMPILE)) { - compile=true; - } else if (tok.equals(SWITCH_CLASS_NAME)) { - targetClassName = nextArg(); - } else if (tok.equals(SWITCH_URI_BASE)) { - uriBase=nextArg(); - } else if (tok.equals(SWITCH_URI_ROOT)) { - setUriroot( nextArg()); - } else if (tok.equals(SWITCH_FILE_WEBAPP)) { - setUriroot( nextArg()); - } else if ( tok.equals( SHOW_SUCCESS ) ) { - showSuccess = true; - } else if ( tok.equals( LIST_ERRORS ) ) { - listErrors = true; - } else if (tok.equals(SWITCH_WEBAPP_INC)) { - webxmlFile = nextArg(); - if (webxmlFile != null) { - webxmlLevel = INC_WEBXML; - } - } else if (tok.equals(SWITCH_WEBAPP_XML)) { - webxmlFile = nextArg(); - if (webxmlFile != null) { - webxmlLevel = ALL_WEBXML; - } - } else if (tok.equals(SWITCH_MAPPED)) { - mappedFile = true; - } else if (tok.equals(SWITCH_XPOWERED_BY)) { - xpoweredBy = true; - } else if (tok.equals(SWITCH_TRIM_SPACES)) { - setTrimSpaces(true); - } else if (tok.equals(SWITCH_CACHE)) { - tok = nextArg(); - if ("false".equals(tok)) { - caching = false; - } else { - caching = true; - } - } else if (tok.equals(SWITCH_CLASSPATH)) { - setClassPath(nextArg()); - } else if (tok.startsWith(SWITCH_DIE)) { - try { - dieLevel = Integer.parseInt( - tok.substring(SWITCH_DIE.length())); - } catch (NumberFormatException nfe) { - dieLevel = DEFAULT_DIE_LEVEL; - } - die = dieLevel; - } else if (tok.equals(SWITCH_HELP)) { - helpNeeded = true; - } else if (tok.equals(SWITCH_POOLING)) { - tok = nextArg(); - if ("false".equals(tok)) { - poolingEnabled = false; - } else { - poolingEnabled = true; - } - } else if (tok.equals(SWITCH_ENCODING)) { - setJavaEncoding(nextArg()); - } else if (tok.equals(SWITCH_SOURCE)) { - setCompilerSourceVM(nextArg()); - } else if (tok.equals(SWITCH_TARGET)) { - setCompilerTargetVM(nextArg()); - } else if (tok.equals(SWITCH_SMAP)) { - smapSuppressed = false; - } else if (tok.equals(SWITCH_DUMP_SMAP)) { - smapDumped = true; - } else { - if (tok.startsWith("-")) { - throw new JasperException("Unrecognized option: " + tok + - ". Use -help for help."); - } - if (!fullstop) { - argPos--; - } - // Start treating the rest as JSP Pages - break; - } - } - - // Add all extra arguments to the list of files - while( true ) { - String file = nextFile(); - if( file==null ) { - break; - } - pages.add( file ); - } - } - - public boolean getKeepGenerated() { - // isn't this why we are running jspc? - return true; - } - - public boolean getTrimSpaces() { - return trimSpaces; - } - - public void setTrimSpaces(boolean ts) { - this.trimSpaces = ts; - } - - public boolean isPoolingEnabled() { - return poolingEnabled; - } - - public void setPoolingEnabled(boolean poolingEnabled) { - this.poolingEnabled = poolingEnabled; - } - - public boolean isXpoweredBy() { - return xpoweredBy; - } - - public void setXpoweredBy(boolean xpoweredBy) { - this.xpoweredBy = xpoweredBy; - } - - public boolean getDisplaySourceFragment() { - return true; - } - - public boolean getErrorOnUseBeanInvalidClassAttribute() { - return errorOnUseBeanInvalidClassAttribute; - } - - public void setErrorOnUseBeanInvalidClassAttribute(boolean b) { - errorOnUseBeanInvalidClassAttribute = b; - } - - public int getTagPoolSize() { - return Constants.MAX_POOL_SIZE; - } - - /** - * Are we supporting HTML mapped servlets? - */ - public boolean getMappedFile() { - return mappedFile; - } - - // Off-line compiler, no need for security manager - public Object getProtectionDomain() { - return null; - } - - /** - * @deprecated - */ - @Deprecated - public boolean getSendErrorToClient() { - return true; - } - - public void setClassDebugInfo( boolean b ) { - classDebugInfo=b; - } - - public boolean getClassDebugInfo() { - // compile with debug info - return classDebugInfo; - } - - /** - * @see Options#isCaching() - */ - public boolean isCaching() { - return caching; - } - - /** - * @see Options#isCaching() - */ - public void setCaching(boolean caching) { - this.caching = caching; - } - - /** - * @see Options#getCache() - */ - public Map getCache() { - return cache; - } - - /** - * Background compilation check intervals in seconds - */ - public int getCheckInterval() { - return 0; - } - - /** - * Modification test interval. - */ - public int getModificationTestInterval() { - return 0; - } - - /** - * Is Jasper being used in development mode? - */ - public boolean getDevelopment() { - return false; - } - - /** - * Is the generation of SMAP info for JSR45 debuggin suppressed? - */ - public boolean isSmapSuppressed() { - return smapSuppressed; - } - - /** - * Set smapSuppressed flag. - */ - public void setSmapSuppressed(boolean smapSuppressed) { - this.smapSuppressed = smapSuppressed; - } - - - /** - * Should SMAP info for JSR45 debugging be dumped to a file? - */ - public boolean isSmapDumped() { - return smapDumped; - } - - /** - * Set smapSuppressed flag. - */ - public void setSmapDumped(boolean smapDumped) { - this.smapDumped = smapDumped; - } - - - /** - * Determines whether text strings are to be generated as char arrays, - * which improves performance in some cases. - * - * @param genStringAsCharArray true if text strings are to be generated as - * char arrays, false otherwise - */ - public void setGenStringAsCharArray(boolean genStringAsCharArray) { - this.genStringAsCharArray = genStringAsCharArray; - } - - /** - * Indicates whether text strings are to be generated as char arrays. - * - * @return true if text strings are to be generated as char arrays, false - * otherwise - */ - public boolean genStringAsCharArray() { - return genStringAsCharArray; - } - - /** - * Sets the class-id value to be sent to Internet Explorer when using - * tags. - * - * @param ieClassId Class-id value - */ - public void setIeClassId(String ieClassId) { - this.ieClassId = ieClassId; - } - - /** - * Gets the class-id value that is sent to Internet Explorer when using - * tags. - * - * @return Class-id value - */ - public String getIeClassId() { - return ieClassId; - } - - public File getScratchDir() { - return scratchDir; - } - - public Class getJspCompilerPlugin() { - // we don't compile, so this is meanlingless - return null; - } - - public String getJspCompilerPath() { - // we don't compile, so this is meanlingless - return null; - } - - /** - * Compiler to use. - */ - public String getCompiler() { - return compiler; - } - - public void setCompiler(String c) { - compiler=c; - } - - /** - * Compiler class name to use. - */ - public String getCompilerClassName() { - return null; - } - - /** - * @see Options#getCompilerTargetVM - */ - public String getCompilerTargetVM() { - return compilerTargetVM; - } - - public void setCompilerTargetVM(String vm) { - compilerTargetVM = vm; - } - - /** - * @see Options#getCompilerSourceVM() - */ - public String getCompilerSourceVM() { - return compilerSourceVM; - } - - /** - * @see Options#getCompilerSourceVM() - */ - public void setCompilerSourceVM(String vm) { - compilerSourceVM = vm; - } - - public TldLocationsCache getTldLocationsCache() { - return tldLocationsCache; - } - - /** - * Returns the encoding to use for - * java files. The default is UTF-8. - * - * @return String The encoding - */ - public String getJavaEncoding() { - return javaEncoding; - } - - /** - * Sets the encoding to use for - * java files. - * - * @param encodingName The name, e.g. "UTF-8" - */ - public void setJavaEncoding(String encodingName) { - javaEncoding = encodingName; - } - - public boolean getFork() { - return false; - } - - public String getClassPath() { - if( classPath != null ) - return classPath; - return System.getProperty("java.class.path"); - } - - public void setClassPath(String s) { - classPath=s; - } - - /** - * Returns the list of file extensions - * that are treated as JSP files. - * - * @return The list of extensions - */ - public List getExtensions() { - return extensions; - } - - /** - * Adds the given file extension to the - * list of extensions handled as JSP files. - * - * @param extension The extension to add, e.g. "myjsp" - */ - protected void addExtension(final String extension) { - if(extension != null) { - if(extensions == null) { - extensions = new Vector(); - } - - extensions.add(extension); - } - } - - /** - * Sets the project. - * - * @param theProject The project - */ - public void setProject(final Project theProject) { - project = theProject; - } - - /** - * Returns the project: may be null if not running - * inside an Ant project. - * - * @return The project - */ - public Project getProject() { - return project; - } - - /** - * Base dir for the webapp. Used to generate class names and resolve - * includes - */ - public void setUriroot( String s ) { - if( s==null ) { - uriRoot = s; - return; - } - try { - uriRoot = resolveFile(s).getCanonicalPath(); - } catch( Exception ex ) { - uriRoot = s; - } - } - - /** - * Parses comma-separated list of JSP files to be processed. If the argument - * is null, nothing is done. - * - *

Each file is interpreted relative to uriroot, unless it is absolute, - * in which case it must start with uriroot.

- * - * @param jspFiles Comma-separated list of JSP files to be processed - */ - public void setJspFiles(final String jspFiles) { - if(jspFiles == null) { - return; - } - - StringTokenizer tok = new StringTokenizer(jspFiles, ","); - while (tok.hasMoreTokens()) { - pages.add(tok.nextToken()); - } - } - - /** - * Sets the compile flag. - * - * @param b Flag value - */ - public void setCompile( final boolean b ) { - compile = b; - } - - /** - * Sets the verbosity level. The actual number doesn't - * matter: if it's greater than zero, the verbose flag will - * be true. - * - * @param level Positive means verbose - */ - public void setVerbose( final int level ) { - if (level > 0) { - verbose = true; - showSuccess = true; - listErrors = true; - } - } - - public void setValidateXml( boolean b ) { - org.apache.jasper.xmlparser.ParserUtils.validating=b; - } - - public void setListErrors( boolean b ) { - listErrors = b; - } - - public void setOutputDir( String s ) { - if( s!= null ) { - scratchDir = resolveFile(s).getAbsoluteFile(); - } else { - scratchDir=null; - } - } - - public void setPackage( String p ) { - targetPackage=p; - } - - /** - * Class name of the generated file ( without package ). - * Can only be used if a single file is converted. - * XXX Do we need this feature ? - */ - public void setClassName( String p ) { - targetClassName=p; - } - - /** - * File where we generate a web.xml fragment with the class definitions. - */ - public void setWebXmlFragment( String s ) { - webxmlFile=resolveFile(s).getAbsolutePath(); - webxmlLevel=INC_WEBXML; - } - - /** - * File where we generate a complete web.xml with the class definitions. - */ - public void setWebXml( String s ) { - webxmlFile=resolveFile(s).getAbsolutePath(); - webxmlLevel=ALL_WEBXML; - } - - public void setAddWebXmlMappings(boolean b) { - addWebXmlMappings = b; - } - - /** - * Set the option that throws an exception in case of a compilation error. - */ - public void setFailOnError(final boolean b) { - failOnError = b; - } - - public boolean getFailOnError() { - return failOnError; - } - - /** - * Obtain JSP configuration informantion specified in web.xml. - */ - public JspConfig getJspConfig() { - return jspConfig; - } - - public TagPluginManager getTagPluginManager() { - return tagPluginManager; - } - - public void generateWebMapping( String file, JspCompilationContext clctxt ) - throws IOException - { - if (log.isDebugEnabled()) { - log.debug("Generating web mapping for file " + file - + " using compilation context " + clctxt); - } - - String className = clctxt.getServletClassName(); - String packageName = clctxt.getServletPackageName(); - - String thisServletName; - if ("".equals(packageName)) { - thisServletName = className; - } else { - thisServletName = packageName + '.' + className; - } - - if (servletout != null) { - servletout.write("\n \n "); - servletout.write(thisServletName); - servletout.write("\n "); - servletout.write(thisServletName); - servletout.write("\n \n"); - } - if (mappingout != null) { - mappingout.write("\n \n "); - mappingout.write(thisServletName); - mappingout.write("\n "); - mappingout.write(file.replace('\\', '/')); - mappingout.write("\n \n"); - - } - } - - /** - * Include the generated web.xml inside the webapp's web.xml. - */ - protected void mergeIntoWebXml() throws IOException { - - File webappBase = new File(uriRoot); - File webXml = new File(webappBase, "WEB-INF/web.xml"); - File webXml2 = new File(webappBase, "WEB-INF/web2.xml"); - String insertStartMarker = - Localizer.getMessage("jspc.webinc.insertStart"); - String insertEndMarker = - Localizer.getMessage("jspc.webinc.insertEnd"); - - BufferedReader reader = new BufferedReader(new FileReader(webXml)); - BufferedReader fragmentReader = - new BufferedReader(new FileReader(webxmlFile)); - PrintWriter writer = new PrintWriter(new FileWriter(webXml2)); - - // Insert the and declarations - int pos = -1; - String line = null; - while (true) { - line = reader.readLine(); - if (line == null) { - break; - } - // Skip anything previously generated by JSPC - if (line.indexOf(insertStartMarker) >= 0) { - while (true) { - line = reader.readLine(); - if (line == null) { - return; - } - if (line.indexOf(insertEndMarker) >= 0) { - line = reader.readLine(); - line = reader.readLine(); - if (line == null) { - return; - } - break; - } - } - } - for (int i = 0; i < insertBefore.length; i++) { - pos = line.indexOf(insertBefore[i]); - if (pos >= 0) - break; - } - if (pos >= 0) { - writer.print(line.substring(0, pos)); - break; - } else { - writer.println(line); - } - } - - writer.println(insertStartMarker); - while (true) { - String line2 = fragmentReader.readLine(); - if (line2 == null) { - writer.println(); - break; - } - writer.println(line2); - } - writer.println(insertEndMarker); - writer.println(); - - for (int i = 0; i < pos; i++) { - writer.print(" "); - } - writer.println(line.substring(pos)); - - while (true) { - line = reader.readLine(); - if (line == null) { - break; - } - writer.println(line); - } - writer.close(); - - reader.close(); - fragmentReader.close(); - - FileInputStream fis = new FileInputStream(webXml2); - FileOutputStream fos = new FileOutputStream(webXml); - - byte buf[] = new byte[512]; - while (true) { - int n = fis.read(buf); - if (n < 0) { - break; - } - fos.write(buf, 0, n); - } - - fis.close(); - fos.close(); - - webXml2.delete(); - (new File(webxmlFile)).delete(); - - } - - protected void processFile(String file) - throws JasperException - { - if (log.isDebugEnabled()) { - log.debug("Processing file: " + file); - } - - ClassLoader originalClassLoader = null; - - try { - // set up a scratch/output dir if none is provided - if (scratchDir == null) { - String temp = System.getProperty("java.io.tmpdir"); - if (temp == null) { - temp = ""; - } - scratchDir = new File(new File(temp).getAbsolutePath()); - } - - String jspUri=file.replace('\\','/'); - JspCompilationContext clctxt = new JspCompilationContext - ( jspUri, false, this, context, null, rctxt ); - - /* Override the defaults */ - if ((targetClassName != null) && (targetClassName.length() > 0)) { - clctxt.setServletClassName(targetClassName); - targetClassName = null; - } - if (targetPackage != null) { - clctxt.setServletPackageName(targetPackage); - } - - originalClassLoader = Thread.currentThread().getContextClassLoader(); - if( loader==null ) { - initClassLoader( clctxt ); - } - Thread.currentThread().setContextClassLoader(loader); - - clctxt.setClassLoader(loader); - clctxt.setClassPath(classPath); - - Compiler clc = clctxt.createCompiler(); - - // If compile is set, generate both .java and .class, if - // .jsp file is newer than .class file; - // Otherwise only generate .java, if .jsp file is newer than - // the .java file - if( clc.isOutDated(compile) ) { - if (log.isDebugEnabled()) { - log.debug(jspUri + " is out dated, compiling..."); - } - - clc.compile(compile, true); - } - - // Generate mapping - generateWebMapping( file, clctxt ); - if ( showSuccess ) { - log.info( "Built File: " + file ); - } - - } catch (JasperException je) { - Throwable rootCause = je; - while (rootCause instanceof JasperException - && ((JasperException) rootCause).getRootCause() != null) { - rootCause = ((JasperException) rootCause).getRootCause(); - } - if (rootCause != je) { - log.error(Localizer.getMessage("jspc.error.generalException", - file), - rootCause); - } - - // Bugzilla 35114. - if(getFailOnError()) { - throw je; - } else { - log.error(je.getMessage()); - } - - } catch (Exception e) { - if ((e instanceof FileNotFoundException) && log.isWarnEnabled()) { - log.warn(Localizer.getMessage("jspc.error.fileDoesNotExist", - e.getMessage())); - } - throw new JasperException(e); - } finally { - if(originalClassLoader != null) { - Thread.currentThread().setContextClassLoader(originalClassLoader); - } - } - } - - /** - * Locate all jsp files in the webapp. Used if no explicit - * jsps are specified. - */ - public void scanFiles( File base ) throws JasperException { - Stack dirs = new Stack(); - dirs.push(base.toString()); - - // Make sure default extensions are always included - if ((getExtensions() == null) || (getExtensions().size() < 2)) { - addExtension("jsp"); - addExtension("jspx"); - } - - while (!dirs.isEmpty()) { - String s = dirs.pop(); - File f = new File(s); - if (f.exists() && f.isDirectory()) { - String[] files = f.list(); - String ext; - for (int i = 0; (files != null) && i < files.length; i++) { - File f2 = new File(s, files[i]); - if (f2.isDirectory()) { - dirs.push(f2.getPath()); - } else { - String path = f2.getPath(); - String uri = path.substring(uriRoot.length()); - ext = files[i].substring(files[i].lastIndexOf('.') +1); - if (getExtensions().contains(ext) || - jspConfig.isJspPage(uri)) { - pages.add(path); - } - } - } - } - } - } - - /** - * Executes the compilation. - * - * @throws JasperException If an error occurs - */ - public void execute() throws JasperException { - if(log.isDebugEnabled()) { - log.debug("execute() starting for " + pages.size() + " pages."); - } - - try { - if (uriRoot == null) { - if( pages.size() == 0 ) { - throw new JasperException( - Localizer.getMessage("jsp.error.jspc.missingTarget")); - } - String firstJsp = (String) pages.get( 0 ); - File firstJspF = new File( firstJsp ); - if (!firstJspF.exists()) { - throw new JasperException( - Localizer.getMessage("jspc.error.fileDoesNotExist", - firstJsp)); - } - locateUriRoot( firstJspF ); - } - - if (uriRoot == null) { - throw new JasperException( - Localizer.getMessage("jsp.error.jspc.no_uriroot")); - } - - if( context==null ) { - initServletContext(); - } - - // No explicit pages, we'll process all .jsp in the webapp - if (pages.size() == 0) { - scanFiles( new File( uriRoot )); - } - - File uriRootF = new File(uriRoot); - if (!uriRootF.exists() || !uriRootF.isDirectory()) { - throw new JasperException( - Localizer.getMessage("jsp.error.jspc.uriroot_not_dir")); - } - - initWebXml(); - - Iterator iter = pages.iterator(); - while (iter.hasNext()) { - String nextjsp = iter.next().toString(); - File fjsp = new File(nextjsp); - if (!fjsp.isAbsolute()) { - fjsp = new File(uriRootF, nextjsp); - } - if (!fjsp.exists()) { - if (log.isWarnEnabled()) { - log.warn - (Localizer.getMessage - ("jspc.error.fileDoesNotExist", fjsp.toString())); - } - continue; - } - String s = fjsp.getAbsolutePath(); - if (s.startsWith(uriRoot)) { - nextjsp = s.substring(uriRoot.length()); - } - if (nextjsp.startsWith("." + File.separatorChar)) { - nextjsp = nextjsp.substring(2); - } - processFile(nextjsp); - } - - completeWebXml(); - - if (addWebXmlMappings) { - mergeIntoWebXml(); - } - - } catch (IOException ioe) { - throw new JasperException(ioe); - - } catch (JasperException je) { - Throwable rootCause = je; - while (rootCause instanceof JasperException - && ((JasperException) rootCause).getRootCause() != null) { - rootCause = ((JasperException) rootCause).getRootCause(); - } - if (rootCause != je) { - rootCause.printStackTrace(); - } - throw je; - } finally { - if (loader != null) { - LogFactory.release(loader); - } - } - } - - // ==================== protected utility methods ==================== - - protected String nextArg() { - if ((argPos >= args.length) - || (fullstop = SWITCH_FULL_STOP.equals(args[argPos]))) { - return null; - } else { - return args[argPos++]; - } - } - - protected String nextFile() { - if (fullstop) argPos++; - if (argPos >= args.length) { - return null; - } else { - return args[argPos++]; - } - } - - protected void initWebXml() { - try { - if (webxmlLevel >= INC_WEBXML) { - File fmapings = new File(webxmlFile); - mapout = new FileWriter(fmapings); - servletout = new CharArrayWriter(); - mappingout = new CharArrayWriter(); - } else { - mapout = null; - servletout = null; - mappingout = null; - } - if (webxmlLevel >= ALL_WEBXML) { - mapout.write(Localizer.getMessage("jspc.webxml.header")); - mapout.flush(); - } else if ((webxmlLevel>= INC_WEBXML) && !addWebXmlMappings) { - mapout.write(Localizer.getMessage("jspc.webinc.header")); - mapout.flush(); - } - } catch (IOException ioe) { - mapout = null; - servletout = null; - mappingout = null; - } - } - - protected void completeWebXml() { - if (mapout != null) { - try { - servletout.writeTo(mapout); - mappingout.writeTo(mapout); - if (webxmlLevel >= ALL_WEBXML) { - mapout.write(Localizer.getMessage("jspc.webxml.footer")); - } else if ((webxmlLevel >= INC_WEBXML) && !addWebXmlMappings) { - mapout.write(Localizer.getMessage("jspc.webinc.footer")); - } - mapout.close(); - } catch (IOException ioe) { - // noting to do if it fails since we are done with it - } - } - } - - protected void initServletContext() { - try { - context =new JspCServletContext - (new PrintWriter(System.out), - new URL("file:" + uriRoot.replace('\\','/') + '/')); - tldLocationsCache = new TldLocationsCache(context, true); - } catch (MalformedURLException me) { - System.out.println("**" + me); - } - rctxt = new JspRuntimeContext(context, this); - jspConfig = new JspConfig(context); - tagPluginManager = new TagPluginManager(context); - } - - /** - * Initializes the classloader as/if needed for the given - * compilation context. - * - * @param clctxt The compilation context - * @throws IOException If an error occurs - */ - protected void initClassLoader(JspCompilationContext clctxt) - throws IOException { - - classPath = getClassPath(); - - ClassLoader jspcLoader = getClass().getClassLoader(); - if (jspcLoader instanceof AntClassLoader) { - classPath += File.pathSeparator - + ((AntClassLoader) jspcLoader).getClasspath(); - } - - // Turn the classPath into URLs - ArrayList urls = new ArrayList(); - StringTokenizer tokenizer = new StringTokenizer(classPath, - File.pathSeparator); - while (tokenizer.hasMoreTokens()) { - String path = tokenizer.nextToken(); - try { - File libFile = new File(path); - urls.add(libFile.toURL()); - } catch (IOException ioe) { - // Failing a toCanonicalPath on a file that - // exists() should be a JVM regression test, - // therefore we have permission to freak uot - throw new RuntimeException(ioe.toString()); - } - } - - File webappBase = new File(uriRoot); - if (webappBase.exists()) { - File classes = new File(webappBase, "/WEB-INF/classes"); - try { - if (classes.exists()) { - classPath = classPath + File.pathSeparator - + classes.getCanonicalPath(); - urls.add(classes.getCanonicalFile().toURL()); - } - } catch (IOException ioe) { - // failing a toCanonicalPath on a file that - // exists() should be a JVM regression test, - // therefore we have permission to freak out - throw new RuntimeException(ioe.toString()); - } - File lib = new File(webappBase, "/WEB-INF/lib"); - if (lib.exists() && lib.isDirectory()) { - String[] libs = lib.list(); - for (int i = 0; i < libs.length; i++) { - if( libs[i].length() <5 ) continue; - String ext=libs[i].substring( libs[i].length() - 4 ); - if (! ".jar".equalsIgnoreCase(ext)) { - if (".tld".equalsIgnoreCase(ext)) { - log.warn("TLD files should not be placed in " - + "/WEB-INF/lib"); - } - continue; - } - try { - File libFile = new File(lib, libs[i]); - classPath = classPath + File.pathSeparator - + libFile.getAbsolutePath(); - urls.add(libFile.getAbsoluteFile().toURL()); - } catch (IOException ioe) { - // failing a toCanonicalPath on a file that - // exists() should be a JVM regression test, - // therefore we have permission to freak out - throw new RuntimeException(ioe.toString()); - } - } - } - } - - // What is this ?? - urls.add(new File(clctxt.getRealPath("/")).getCanonicalFile().toURL()); - - URL urlsA[]=new URL[urls.size()]; - urls.toArray(urlsA); - loader = new URLClassLoader(urlsA, this.getClass().getClassLoader()); - - } - - /** - * Find the WEB-INF dir by looking up in the directory tree. - * This is used if no explicit docbase is set, but only files. - * XXX Maybe we should require the docbase. - */ - protected void locateUriRoot( File f ) { - String tUriBase = uriBase; - if (tUriBase == null) { - tUriBase = "/"; - } - try { - if (f.exists()) { - f = new File(f.getAbsolutePath()); - while (f != null) { - File g = new File(f, "WEB-INF"); - if (g.exists() && g.isDirectory()) { - uriRoot = f.getCanonicalPath(); - uriBase = tUriBase; - if (log.isInfoEnabled()) { - log.info(Localizer.getMessage( - "jspc.implicit.uriRoot", - uriRoot)); - } - break; - } - if (f.exists() && f.isDirectory()) { - tUriBase = "/" + f.getName() + "/" + tUriBase; - } - - String fParent = f.getParent(); - if (fParent == null) { - break; - } else { - f = new File(fParent); - } - - // If there is no acceptible candidate, uriRoot will - // remain null to indicate to the CompilerContext to - // use the current working/user dir. - } - - if (uriRoot != null) { - File froot = new File(uriRoot); - uriRoot = froot.getCanonicalPath(); - } - } - } catch (IOException ioe) { - // since this is an optional default and a null value - // for uriRoot has a non-error meaning, we can just - // pass straight through - } - } - - /** - * Resolves the relative or absolute pathname correctly - * in both Ant and command-line situations. If Ant launched - * us, we should use the basedir of the current project - * to resolve relative paths. - * - * See Bugzilla 35571. - * - * @param s The file - * @return The file resolved - */ - protected File resolveFile(final String s) { - if(getProject() == null) { - // Note FileUtils.getFileUtils replaces FileUtils.newFileUtils in Ant 1.6.3 - return FileUtils.newFileUtils().resolveFile(null, s); - } else { - return FileUtils.newFileUtils().resolveFile(getProject().getBaseDir(), s); - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JspCompilationContext.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JspCompilationContext.java deleted file mode 100644 index 813cf9bf2..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/JspCompilationContext.java +++ /dev/null @@ -1,738 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper; - -import java.io.File; -import java.io.FileNotFoundException; -import java.net.MalformedURLException; -import java.net.URL; -import java.net.URLClassLoader; -import java.util.HashMap; -import java.util.Map; -import java.util.Set; - -import javax.servlet.ServletContext; -import javax.servlet.jsp.tagext.TagInfo; - -import org.apache.jasper.compiler.Compiler; -import org.apache.jasper.compiler.JspRuntimeContext; -import org.apache.jasper.compiler.JspUtil; -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.compiler.ServletWriter; -import org.apache.jasper.servlet.JasperLoader; -import org.apache.jasper.servlet.JspServletWrapper; - -/** - * A place holder for various things that are used through out the JSP - * engine. This is a per-request/per-context data structure. Some of - * the instance variables are set at different points. - * - * Most of the path-related stuff is here - mangling names, versions, dirs, - * loading resources and dealing with uris. - * - * @author Anil K. Vijendran - * @author Harish Prabandham - * @author Pierre Delisle - * @author Costin Manolache - * @author Kin-man Chung - */ -public class JspCompilationContext { - - protected org.apache.juli.logging.Log log = - org.apache.juli.logging.LogFactory.getLog(JspCompilationContext.class); - - protected Map tagFileJarUrls; - protected boolean isPackagedTagFile; - - protected String className; - protected String jspUri; - protected boolean isErrPage; - protected String basePackageName; - protected String derivedPackageName; - protected String servletJavaFileName; - protected String javaPath; - protected String classFileName; - protected String contentType; - protected ServletWriter writer; - protected Options options; - protected JspServletWrapper jsw; - protected Compiler jspCompiler; - protected String classPath; - - protected String baseURI; - protected String outputDir; - protected ServletContext context; - protected URLClassLoader loader; - - protected JspRuntimeContext rctxt; - - protected int removed = 0; - - protected URLClassLoader jspLoader; - protected URL baseUrl; - protected Class servletClass; - - protected boolean isTagFile; - protected boolean protoTypeMode; - protected TagInfo tagInfo; - protected URL tagFileJarUrl; - - // jspURI _must_ be relative to the context - public JspCompilationContext(String jspUri, - boolean isErrPage, - Options options, - ServletContext context, - JspServletWrapper jsw, - JspRuntimeContext rctxt) { - - this.jspUri = canonicalURI(jspUri); - this.isErrPage = isErrPage; - this.options = options; - this.jsw = jsw; - this.context = context; - - this.baseURI = jspUri.substring(0, jspUri.lastIndexOf('/') + 1); - // hack fix for resolveRelativeURI - if (baseURI == null) { - baseURI = "/"; - } else if (baseURI.charAt(0) != '/') { - // strip the basde slash since it will be combined with the - // uriBase to generate a file - baseURI = "/" + baseURI; - } - if (baseURI.charAt(baseURI.length() - 1) != '/') { - baseURI += '/'; - } - - this.rctxt = rctxt; - this.tagFileJarUrls = new HashMap(); - this.basePackageName = Constants.JSP_PACKAGE_NAME; - } - - public JspCompilationContext(String tagfile, - TagInfo tagInfo, - Options options, - ServletContext context, - JspServletWrapper jsw, - JspRuntimeContext rctxt, - URL tagFileJarUrl) { - this(tagfile, false, options, context, jsw, rctxt); - this.isTagFile = true; - this.tagInfo = tagInfo; - this.tagFileJarUrl = tagFileJarUrl; - if (tagFileJarUrl != null) { - isPackagedTagFile = true; - } - } - - /* ==================== Methods to override ==================== */ - - /** ---------- Class path and loader ---------- */ - - /** - * The classpath that is passed off to the Java compiler. - */ - public String getClassPath() { - if( classPath != null ) - return classPath; - return rctxt.getClassPath(); - } - - /** - * The classpath that is passed off to the Java compiler. - */ - public void setClassPath(String classPath) { - this.classPath = classPath; - } - - /** - * What class loader to use for loading classes while compiling - * this JSP? - */ - public ClassLoader getClassLoader() { - if( loader != null ) - return loader; - return rctxt.getParentClassLoader(); - } - - public void setClassLoader(URLClassLoader loader) { - this.loader = loader; - } - - public ClassLoader getJspLoader() { - if( jspLoader == null ) { - jspLoader = new JasperLoader - (new URL[] {baseUrl}, - getClassLoader(), - rctxt.getPermissionCollection(), - rctxt.getCodeSource()); - } - return jspLoader; - } - - /** ---------- Input/Output ---------- */ - - /** - * The output directory to generate code into. The output directory - * is make up of the scratch directory, which is provide in Options, - * plus the directory derived from the package name. - */ - public String getOutputDir() { - if (outputDir == null) { - createOutputDir(); - } - - return outputDir; - } - - /** - * Create a "Compiler" object based on some init param data. This - * is not done yet. Right now we're just hardcoding the actual - * compilers that are created. - */ - public Compiler createCompiler() throws JasperException { - if (jspCompiler != null ) { - return jspCompiler; - } - jspCompiler = null; - if (options.getCompilerClassName() != null) { - jspCompiler = createCompiler(options.getCompilerClassName()); - } else { - if (options.getCompiler() == null) { - jspCompiler = createCompiler("org.apache.jasper.compiler.JDTCompiler"); - if (jspCompiler == null) { - jspCompiler = createCompiler("org.apache.jasper.compiler.AntCompiler"); - } - } else { - jspCompiler = createCompiler("org.apache.jasper.compiler.AntCompiler"); - if (jspCompiler == null) { - jspCompiler = createCompiler("org.apache.jasper.compiler.JDTCompiler"); - } - } - } - if (jspCompiler == null) { - throw new IllegalStateException(Localizer.getMessage("jsp.error.compiler")); - } - jspCompiler.init(this, jsw); - return jspCompiler; - } - - protected Compiler createCompiler(String className) { - Compiler compiler = null; - try { - compiler = (Compiler) Class.forName(className).newInstance(); - } catch (InstantiationException e) { - log.warn(Localizer.getMessage("jsp.error.compiler"), e); - } catch (IllegalAccessException e) { - log.warn(Localizer.getMessage("jsp.error.compiler"), e); - } catch (NoClassDefFoundError e) { - if (log.isDebugEnabled()) { - log.debug(Localizer.getMessage("jsp.error.compiler"), e); - } - } catch (ClassNotFoundException e) { - if (log.isDebugEnabled()) { - log.debug(Localizer.getMessage("jsp.error.compiler"), e); - } - } - return compiler; - } - - public Compiler getCompiler() { - return jspCompiler; - } - - /** ---------- Access resources in the webapp ---------- */ - - /** - * Get the full value of a URI relative to this compilations context - * uses current file as the base. - */ - public String resolveRelativeUri(String uri) { - // sometimes we get uri's massaged from File(String), so check for - // a root directory deperator char - if (uri.startsWith("/") || uri.startsWith(File.separator)) { - return uri; - } else { - return baseURI + uri; - } - } - - /** - * Gets a resource as a stream, relative to the meanings of this - * context's implementation. - * @return a null if the resource cannot be found or represented - * as an InputStream. - */ - public java.io.InputStream getResourceAsStream(String res) { - return context.getResourceAsStream(canonicalURI(res)); - } - - - public URL getResource(String res) throws MalformedURLException { - URL result = null; - - if (res.startsWith("/META-INF/")) { - // This is a tag file packaged in a jar that is being compiled - URL jarUrl = tagFileJarUrls.get(res); - if (jarUrl == null) { - jarUrl = tagFileJarUrl; - } - if (jarUrl != null) { - result = new URL(jarUrl.toExternalForm() + res.substring(1)); - } - } else if (res.startsWith("jar:file:")) { - // This is a tag file packaged in a jar that is being checked - // for a dependency - result = new URL(res); - - } else { - result = context.getResource(canonicalURI(res)); - } - return result; - } - - - public Set getResourcePaths(String path) { - return context.getResourcePaths(canonicalURI(path)); - } - - /** - * Gets the actual path of a URI relative to the context of - * the compilation. - */ - public String getRealPath(String path) { - if (context != null) { - return context.getRealPath(path); - } - return path; - } - - /** - * Returns the tag-file-name-to-JAR-file map of this compilation unit, - * which maps tag file names to the JAR files in which the tag files are - * packaged. - * - * The map is populated when parsing the tag-file elements of the TLDs - * of any imported taglibs. - */ - public URL getTagFileJarUrl(String tagFile) { - return this.tagFileJarUrls.get(tagFile); - } - - public void setTagFileJarUrl(String tagFile, URL tagFileURL) { - this.tagFileJarUrls.put(tagFile, tagFileURL); - } - - /** - * Returns the JAR file in which the tag file for which this - * JspCompilationContext was created is packaged, or null if this - * JspCompilationContext does not correspond to a tag file, or if the - * corresponding tag file is not packaged in a JAR. - */ - public URL getTagFileJarUrl() { - return this.tagFileJarUrl; - } - - /* ==================== Common implementation ==================== */ - - /** - * Just the class name (does not include package name) of the - * generated class. - */ - public String getServletClassName() { - - if (className != null) { - return className; - } - - if (isTagFile) { - className = tagInfo.getTagClassName(); - int lastIndex = className.lastIndexOf('.'); - if (lastIndex != -1) { - className = className.substring(lastIndex + 1); - } - } else { - int iSep = jspUri.lastIndexOf('/') + 1; - className = JspUtil.makeJavaIdentifier(jspUri.substring(iSep)); - } - return className; - } - - public void setServletClassName(String className) { - this.className = className; - } - - /** - * Path of the JSP URI. Note that this is not a file name. This is - * the context rooted URI of the JSP file. - */ - public String getJspFile() { - return jspUri; - } - - /** - * Are we processing something that has been declared as an - * errorpage? - */ - public boolean isErrorPage() { - return isErrPage; - } - - public void setErrorPage(boolean isErrPage) { - this.isErrPage = isErrPage; - } - - public boolean isTagFile() { - return isTagFile; - } - - public TagInfo getTagInfo() { - return tagInfo; - } - - public void setTagInfo(TagInfo tagi) { - tagInfo = tagi; - } - - /** - * True if we are compiling a tag file in prototype mode. - * ie we only generate codes with class for the tag handler with empty - * method bodies. - */ - public boolean isPrototypeMode() { - return protoTypeMode; - } - - public void setPrototypeMode(boolean pm) { - protoTypeMode = pm; - } - - /** - * Package name for the generated class is make up of the base package - * name, which is user settable, and the derived package name. The - * derived package name directly mirrors the file heirachy of the JSP page. - */ - public String getServletPackageName() { - if (isTagFile()) { - String className = tagInfo.getTagClassName(); - int lastIndex = className.lastIndexOf('.'); - String pkgName = ""; - if (lastIndex != -1) { - pkgName = className.substring(0, lastIndex); - } - return pkgName; - } else { - String dPackageName = getDerivedPackageName(); - if (dPackageName.length() == 0) { - return basePackageName; - } - return basePackageName + '.' + getDerivedPackageName(); - } - } - - protected String getDerivedPackageName() { - if (derivedPackageName == null) { - int iSep = jspUri.lastIndexOf('/'); - derivedPackageName = (iSep > 0) ? - JspUtil.makeJavaPackage(jspUri.substring(1,iSep)) : ""; - } - return derivedPackageName; - } - - /** - * The package name into which the servlet class is generated. - */ - public void setServletPackageName(String servletPackageName) { - this.basePackageName = servletPackageName; - } - - /** - * Full path name of the Java file into which the servlet is being - * generated. - */ - public String getServletJavaFileName() { - if (servletJavaFileName == null) { - servletJavaFileName = getOutputDir() + getServletClassName() + ".java"; - } - return servletJavaFileName; - } - - /** - * Get hold of the Options object for this context. - */ - public Options getOptions() { - return options; - } - - public ServletContext getServletContext() { - return context; - } - - public JspRuntimeContext getRuntimeContext() { - return rctxt; - } - - /** - * Path of the Java file relative to the work directory. - */ - public String getJavaPath() { - - if (javaPath != null) { - return javaPath; - } - - if (isTagFile()) { - String tagName = tagInfo.getTagClassName(); - javaPath = tagName.replace('.', '/') + ".java"; - } else { - javaPath = getServletPackageName().replace('.', '/') + '/' + - getServletClassName() + ".java"; - } - return javaPath; - } - - public String getClassFileName() { - if (classFileName == null) { - classFileName = getOutputDir() + getServletClassName() + ".class"; - } - return classFileName; - } - - /** - * Get the content type of this JSP. - * - * Content type includes content type and encoding. - */ - public String getContentType() { - return contentType; - } - - public void setContentType(String contentType) { - this.contentType = contentType; - } - - /** - * Where is the servlet being generated? - */ - public ServletWriter getWriter() { - return writer; - } - - public void setWriter(ServletWriter writer) { - this.writer = writer; - } - - /** - * Gets the 'location' of the TLD associated with the given taglib 'uri'. - * - * @return An array of two Strings: The first element denotes the real - * path to the TLD. If the path to the TLD points to a jar file, then the - * second element denotes the name of the TLD entry in the jar file. - * Returns null if the given uri is not associated with any tag library - * 'exposed' in the web application. - */ - public String[] getTldLocation(String uri) throws JasperException { - String[] location = - getOptions().getTldLocationsCache().getLocation(uri); - return location; - } - - /** - * Are we keeping generated code around? - */ - public boolean keepGenerated() { - return getOptions().getKeepGenerated(); - } - - // ==================== Removal ==================== - - public void incrementRemoved() { - if (removed == 0 && rctxt != null) { - rctxt.removeWrapper(jspUri); - } - removed++; - } - - public boolean isRemoved() { - if (removed > 1 ) { - return true; - } - return false; - } - - // ==================== Compile and reload ==================== - - public void compile() throws JasperException, FileNotFoundException { - createCompiler(); - if (jspCompiler.isOutDated()) { - try { - jspCompiler.removeGeneratedFiles(); - jspLoader = null; - jspCompiler.compile(); - jsw.setReload(true); - jsw.setCompilationException(null); - } catch (JasperException ex) { - // Cache compilation exception - jsw.setCompilationException(ex); - throw ex; - } catch (Exception ex) { - JasperException je = new JasperException( - Localizer.getMessage("jsp.error.unable.compile"), - ex); - // Cache compilation exception - jsw.setCompilationException(je); - throw je; - } - } - } - - // ==================== Manipulating the class ==================== - - public Class load() - throws JasperException, FileNotFoundException - { - try { - getJspLoader(); - - String name; - if (isTagFile()) { - name = tagInfo.getTagClassName(); - } else { - name = getServletPackageName() + "." + getServletClassName(); - } - servletClass = jspLoader.loadClass(name); - } catch (ClassNotFoundException cex) { - throw new JasperException(Localizer.getMessage("jsp.error.unable.load"), - cex); - } catch (Exception ex) { - throw new JasperException(Localizer.getMessage("jsp.error.unable.compile"), - ex); - } - removed = 0; - return servletClass; - } - - // ==================== protected methods ==================== - - static Object outputDirLock = new Object(); - - public void checkOutputDir() { - if (outputDir != null) { - if (!(new File(outputDir)).exists()) { - makeOutputDir(); - } - } else { - createOutputDir(); - } - } - - protected boolean makeOutputDir() { - synchronized(outputDirLock) { - File outDirFile = new File(outputDir); - return (outDirFile.exists() || outDirFile.mkdirs()); - } - } - - protected void createOutputDir() { - String path = null; - if (isTagFile()) { - String tagName = tagInfo.getTagClassName(); - path = tagName.replace('.', File.separatorChar); - path = path.substring(0, path.lastIndexOf(File.separatorChar)); - } else { - path = getServletPackageName().replace('.',File.separatorChar); - } - - // Append servlet or tag handler path to scratch dir - try { - File base = options.getScratchDir(); - baseUrl = base.toURI().toURL(); - outputDir = base.getAbsolutePath() + File.separator + path + - File.separator; - if (!makeOutputDir()) { - throw new IllegalStateException(Localizer.getMessage("jsp.error.outputfolder")); - } - } catch (MalformedURLException e) { - throw new IllegalStateException(Localizer.getMessage("jsp.error.outputfolder"), e); - } - } - - protected static final boolean isPathSeparator(char c) { - return (c == '/' || c == '\\'); - } - - protected static final String canonicalURI(String s) { - if (s == null) return null; - StringBuffer result = new StringBuffer(); - final int len = s.length(); - int pos = 0; - while (pos < len) { - char c = s.charAt(pos); - if ( isPathSeparator(c) ) { - /* - * multiple path separators. - * 'foo///bar' -> 'foo/bar' - */ - while (pos+1 < len && isPathSeparator(s.charAt(pos+1))) { - ++pos; - } - - if (pos+1 < len && s.charAt(pos+1) == '.') { - /* - * a single dot at the end of the path - we are done. - */ - if (pos+2 >= len) break; - - switch (s.charAt(pos+2)) { - /* - * self directory in path - * foo/./bar -> foo/bar - */ - case '/': - case '\\': - pos += 2; - continue; - - /* - * two dots in a path: go back one hierarchy. - * foo/bar/../baz -> foo/baz - */ - case '.': - // only if we have exactly _two_ dots. - if (pos+3 < len && isPathSeparator(s.charAt(pos+3))) { - pos += 3; - int separatorPos = result.length()-1; - while (separatorPos >= 0 && - ! isPathSeparator(result - .charAt(separatorPos))) { - --separatorPos; - } - if (separatorPos >= 0) - result.setLength(separatorPos); - continue; - } - } - } - } - result.append(c); - ++pos; - } - return result.toString(); - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/Options.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/Options.java deleted file mode 100644 index f52b370c1..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/Options.java +++ /dev/null @@ -1,202 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper; - -import java.io.File; -import java.util.Map; - -import org.apache.jasper.compiler.JspConfig; -import org.apache.jasper.compiler.TagPluginManager; -import org.apache.jasper.compiler.TldLocationsCache; - -/** - * A class to hold all init parameters specific to the JSP engine. - * - * @author Anil K. Vijendran - * @author Hans Bergsten - * @author Pierre Delisle - */ -public interface Options { - - /** - * Returns true if Jasper issues a compilation error instead of a runtime - * Instantiation error if the class attribute specified in useBean action - * is invalid. - */ - public boolean getErrorOnUseBeanInvalidClassAttribute(); - - /** - * Are we keeping generated code around? - */ - public boolean getKeepGenerated(); - - /** - * Returns true if tag handler pooling is enabled, false otherwise. - */ - public boolean isPoolingEnabled(); - - /** - * Are we supporting HTML mapped servlets? - */ - public boolean getMappedFile(); - - /** - * Should errors be sent to client or thrown into stderr? - * @deprecated - */ - @Deprecated - public boolean getSendErrorToClient(); - - /** - * Should we include debug information in compiled class? - */ - public boolean getClassDebugInfo(); - - /** - * Background compile thread check interval in seconds - */ - public int getCheckInterval(); - - /** - * Is Jasper being used in development mode? - */ - public boolean getDevelopment(); - - /** - * Should we include a source fragment in exception messages, which could be displayed - * to the developer ? - */ - public boolean getDisplaySourceFragment(); - - /** - * Is the generation of SMAP info for JSR45 debugging suppressed? - */ - public boolean isSmapSuppressed(); - - /** - * Indicates whether SMAP info for JSR45 debugging should be dumped to a - * file. - * Ignored is suppressSmap() is true - */ - public boolean isSmapDumped(); - - /** - * Should white spaces between directives or actions be trimmed? - */ - public boolean getTrimSpaces(); - - /** - * Class ID for use in the plugin tag when the browser is IE. - */ - public String getIeClassId(); - - /** - * What is my scratch dir? - */ - public File getScratchDir(); - - /** - * What classpath should I use while compiling the servlets - * generated from JSP files? - */ - public String getClassPath(); - - /** - * Compiler to use. - */ - public String getCompiler(); - - /** - * The compiler target VM, e.g. 1.1, 1.2, 1.3, 1.4, or 1.5. - */ - public String getCompilerTargetVM(); - - /** - * Compiler source VM, e.g. 1.3, 1.4, or 1.5. - */ - public String getCompilerSourceVM(); - - /** - * Java compiler class to use. - */ - public String getCompilerClassName(); - - /** - * The cache for the location of the TLD's - * for the various tag libraries 'exposed' - * by the web application. - * A tag library is 'exposed' either explicitely in - * web.xml or implicitely via the uri tag in the TLD - * of a taglib deployed in a jar file (WEB-INF/lib). - * - * @return the instance of the TldLocationsCache - * for the web-application. - */ - public TldLocationsCache getTldLocationsCache(); - - /** - * Java platform encoding to generate the JSP - * page servlet. - */ - public String getJavaEncoding(); - - /** - * boolean flag to tell Ant whether to fork JSP page compilations. - */ - public boolean getFork(); - - /** - * Obtain JSP configuration informantion specified in web.xml. - */ - public JspConfig getJspConfig(); - - /** - * Is generation of X-Powered-By response header enabled/disabled? - */ - public boolean isXpoweredBy(); - - /** - * Obtain a Tag Plugin Manager - */ - public TagPluginManager getTagPluginManager(); - - /** - * Are Text strings to be generated as char arrays? - */ - public boolean genStringAsCharArray(); - - /** - * Modification test interval. - */ - public int getModificationTestInterval(); - - /** - * Is caching enabled (used for precompilation). - */ - public boolean isCaching(); - - /** - * The web-application wide cache for the returned TreeNode - * by parseXMLDocument in TagLibraryInfoImpl.parseTLD, - * if isCaching returns true. - * - * @return the Map(String uri, TreeNode tld) instance. - */ - public Map getCache(); - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/AntCompiler.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/AntCompiler.java deleted file mode 100644 index 351267a5b..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/AntCompiler.java +++ /dev/null @@ -1,493 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.ByteArrayOutputStream; -import java.io.File; -import java.io.FileNotFoundException; -import java.io.IOException; -import java.io.PrintStream; -import java.util.StringTokenizer; - -import org.apache.jasper.JasperException; -import org.apache.tools.ant.BuildException; -import org.apache.tools.ant.DefaultLogger; -import org.apache.tools.ant.Project; -import org.apache.tools.ant.taskdefs.Javac; -import org.apache.tools.ant.types.Path; -import org.apache.tools.ant.types.PatternSet; - -/** - * Main JSP compiler class. This class uses Ant for compiling. - * - * @author Anil K. Vijendran - * @author Mandar Raje - * @author Pierre Delisle - * @author Kin-man Chung - * @author Remy Maucherat - * @author Mark Roth - */ -public class AntCompiler extends Compiler { - - protected static Object javacLock = new Object(); - - static { - System.setErr(new SystemLogHandler(System.err)); - } - - // ----------------------------------------------------- Instance Variables - - protected Project project = null; - protected JasperAntLogger logger; - - // ------------------------------------------------------------ Constructor - - // Lazy eval - if we don't need to compile we probably don't need the project - protected Project getProject() { - - if (project != null) - return project; - - // Initializing project - project = new Project(); - logger = new JasperAntLogger(); - logger.setOutputPrintStream(System.out); - logger.setErrorPrintStream(System.err); - logger.setMessageOutputLevel(Project.MSG_INFO); - project.addBuildListener( logger); - if (System.getProperty("catalina.home") != null) { - project.setBasedir( System.getProperty("catalina.home")); - } - - if( options.getCompiler() != null ) { - if( log.isDebugEnabled() ) - log.debug("Compiler " + options.getCompiler() ); - project.setProperty("build.compiler", options.getCompiler() ); - } - project.init(); - return project; - } - - public class JasperAntLogger extends DefaultLogger { - - protected StringBuffer reportBuf = new StringBuffer(); - - protected void printMessage(final String message, - final PrintStream stream, - final int priority) { - } - - protected void log(String message) { - reportBuf.append(message); - reportBuf.append(System.getProperty("line.separator")); - } - - protected String getReport() { - String report = reportBuf.toString(); - reportBuf.setLength(0); - return report; - } - } - - // --------------------------------------------------------- Public Methods - - - /** - * Compile the servlet from .java file to .class file - */ - protected void generateClass(String[] smap) - throws FileNotFoundException, JasperException, Exception { - - long t1 = 0; - if (log.isDebugEnabled()) { - t1 = System.currentTimeMillis(); - } - - String javaEncoding = ctxt.getOptions().getJavaEncoding(); - String javaFileName = ctxt.getServletJavaFileName(); - String classpath = ctxt.getClassPath(); - - String sep = System.getProperty("path.separator"); - - StringBuffer errorReport = new StringBuffer(); - - StringBuffer info=new StringBuffer(); - info.append("Compile: javaFileName=" + javaFileName + "\n" ); - info.append(" classpath=" + classpath + "\n" ); - - // Start capturing the System.err output for this thread - SystemLogHandler.setThread(); - - // Initializing javac task - getProject(); - Javac javac = (Javac) project.createTask("javac"); - - // Initializing classpath - Path path = new Path(project); - path.setPath(System.getProperty("java.class.path")); - info.append(" cp=" + System.getProperty("java.class.path") + "\n"); - StringTokenizer tokenizer = new StringTokenizer(classpath, sep); - while (tokenizer.hasMoreElements()) { - String pathElement = tokenizer.nextToken(); - File repository = new File(pathElement); - path.setLocation(repository); - info.append(" cp=" + repository + "\n"); - } - - if( log.isDebugEnabled() ) - log.debug( "Using classpath: " + System.getProperty("java.class.path") + sep - + classpath); - - // Initializing sourcepath - Path srcPath = new Path(project); - srcPath.setLocation(options.getScratchDir()); - - info.append(" work dir=" + options.getScratchDir() + "\n"); - - // Initialize and set java extensions - String exts = System.getProperty("java.ext.dirs"); - if (exts != null) { - Path extdirs = new Path(project); - extdirs.setPath(exts); - javac.setExtdirs(extdirs); - info.append(" extension dir=" + exts + "\n"); - } - - // Add endorsed directories if any are specified and we're forking - // See Bugzilla 31257 - if(ctxt.getOptions().getFork()) { - String endorsed = System.getProperty("java.endorsed.dirs"); - if(endorsed != null) { - Javac.ImplementationSpecificArgument endorsedArg = - javac.createCompilerArg(); - endorsedArg.setLine("-J-Djava.endorsed.dirs=" + - quotePathList(endorsed)); - info.append(" endorsed dir=" + quotePathList(endorsed) + - "\n"); - } else { - info.append(" no endorsed dirs specified\n"); - } - } - - // Configure the compiler object - javac.setEncoding(javaEncoding); - javac.setClasspath(path); - javac.setDebug(ctxt.getOptions().getClassDebugInfo()); - javac.setSrcdir(srcPath); - javac.setTempdir(options.getScratchDir()); - javac.setOptimize(! ctxt.getOptions().getClassDebugInfo() ); - javac.setFork(ctxt.getOptions().getFork()); - info.append(" srcDir=" + srcPath + "\n" ); - - // Set the Java compiler to use - if (options.getCompiler() != null) { - javac.setCompiler(options.getCompiler()); - info.append(" compiler=" + options.getCompiler() + "\n"); - } - - if (options.getCompilerTargetVM() != null) { - javac.setTarget(options.getCompilerTargetVM()); - info.append(" compilerTargetVM=" + options.getCompilerTargetVM() + "\n"); - } - - if (options.getCompilerSourceVM() != null) { - javac.setSource(options.getCompilerSourceVM()); - info.append(" compilerSourceVM=" + options.getCompilerSourceVM() + "\n"); - } - - // Build includes path - PatternSet.NameEntry includes = javac.createInclude(); - - includes.setName(ctxt.getJavaPath()); - info.append(" include="+ ctxt.getJavaPath() + "\n" ); - - BuildException be = null; - - try { - if (ctxt.getOptions().getFork()) { - javac.execute(); - } else { - synchronized(javacLock) { - javac.execute(); - } - } - } catch (BuildException e) { - be = e; - log.error(Localizer.getMessage("jsp.error.javac"), e); - log.error(Localizer.getMessage("jsp.error.javac.env") + info.toString()); - } - - errorReport.append(logger.getReport()); - - // Stop capturing the System.err output for this thread - String errorCapture = SystemLogHandler.unsetThread(); - if (errorCapture != null) { - errorReport.append(System.getProperty("line.separator")); - errorReport.append(errorCapture); - } - - if (!ctxt.keepGenerated()) { - File javaFile = new File(javaFileName); - javaFile.delete(); - } - - if (be != null) { - String errorReportString = errorReport.toString(); - log.error(Localizer.getMessage("jsp.error.compilation", javaFileName, errorReportString)); - JavacErrorDetail[] javacErrors = ErrorDispatcher.parseJavacErrors( - errorReportString, javaFileName, pageNodes); - if (javacErrors != null) { - errDispatcher.javacError(javacErrors); - } else { - errDispatcher.javacError(errorReportString, be); - } - } - - if( log.isDebugEnabled() ) { - long t2 = System.currentTimeMillis(); - log.debug("Compiled " + ctxt.getServletJavaFileName() + " " - + (t2-t1) + "ms"); - } - - logger = null; - project = null; - - if (ctxt.isPrototypeMode()) { - return; - } - - // JSR45 Support - if (! options.isSmapSuppressed()) { - SmapUtil.installSmap(smap); - } - } - - private String quotePathList(String list) { - StringBuffer result = new StringBuffer(list.length() + 10); - StringTokenizer st = new StringTokenizer(list, File.pathSeparator); - while (st.hasMoreTokens()) { - String token = st.nextToken(); - if (token.indexOf(' ') == -1) { - result.append(token); - } else { - result.append('\"'); - result.append(token); - result.append('\"'); - } - if (st.hasMoreTokens()) { - result.append(File.pathSeparatorChar); - } - } - return result.toString(); - } - - - protected static class SystemLogHandler extends PrintStream { - - - // ----------------------------------------------------------- Constructors - - - /** - * Construct the handler to capture the output of the given steam. - */ - public SystemLogHandler(PrintStream wrapped) { - super(wrapped); - this.wrapped = wrapped; - } - - - // ----------------------------------------------------- Instance Variables - - - /** - * Wrapped PrintStream. - */ - protected PrintStream wrapped = null; - - - /** - * Thread <-> PrintStream associations. - */ - protected static ThreadLocal streams = new ThreadLocal(); - - - /** - * Thread <-> ByteArrayOutputStream associations. - */ - protected static ThreadLocal data = new ThreadLocal(); - - - // --------------------------------------------------------- Public Methods - - - public PrintStream getWrapped() { - return wrapped; - } - - /** - * Start capturing thread's output. - */ - public static void setThread() { - ByteArrayOutputStream baos = new ByteArrayOutputStream(); - data.set(baos); - streams.set(new PrintStream(baos)); - } - - - /** - * Stop capturing thread's output and return captured data as a String. - */ - public static String unsetThread() { - ByteArrayOutputStream baos = - (ByteArrayOutputStream) data.get(); - if (baos == null) { - return null; - } - streams.set(null); - data.set(null); - return baos.toString(); - } - - - // ------------------------------------------------------ Protected Methods - - - /** - * Find PrintStream to which the output must be written to. - */ - protected PrintStream findStream() { - PrintStream ps = (PrintStream) streams.get(); - if (ps == null) { - ps = wrapped; - } - return ps; - } - - - // ---------------------------------------------------- PrintStream Methods - - - public void flush() { - findStream().flush(); - } - - public void close() { - findStream().close(); - } - - public boolean checkError() { - return findStream().checkError(); - } - - protected void setError() { - //findStream().setError(); - } - - public void write(int b) { - findStream().write(b); - } - - public void write(byte[] b) - throws IOException { - findStream().write(b); - } - - public void write(byte[] buf, int off, int len) { - findStream().write(buf, off, len); - } - - public void print(boolean b) { - findStream().print(b); - } - - public void print(char c) { - findStream().print(c); - } - - public void print(int i) { - findStream().print(i); - } - - public void print(long l) { - findStream().print(l); - } - - public void print(float f) { - findStream().print(f); - } - - public void print(double d) { - findStream().print(d); - } - - public void print(char[] s) { - findStream().print(s); - } - - public void print(String s) { - findStream().print(s); - } - - public void print(Object obj) { - findStream().print(obj); - } - - public void println() { - findStream().println(); - } - - public void println(boolean x) { - findStream().println(x); - } - - public void println(char x) { - findStream().println(x); - } - - public void println(int x) { - findStream().println(x); - } - - public void println(long x) { - findStream().println(x); - } - - public void println(float x) { - findStream().println(x); - } - - public void println(double x) { - findStream().println(x); - } - - public void println(char[] x) { - findStream().println(x); - } - - public void println(String x) { - findStream().println(x); - } - - public void println(Object x) { - findStream().println(x); - } - - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/BeanRepository.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/BeanRepository.java deleted file mode 100644 index cd32b7fa4..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/BeanRepository.java +++ /dev/null @@ -1,75 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - - -import java.util.HashMap; - -import org.apache.jasper.JasperException; - -/** - * Repository of {page, request, session, application}-scoped beans - * - * @author Mandar Raje - * @author Remy Maucherat - */ -public class BeanRepository { - - protected HashMap beanTypes; - protected ClassLoader loader; - protected ErrorDispatcher errDispatcher; - - /** - * Constructor. - */ - public BeanRepository(ClassLoader loader, ErrorDispatcher err) { - this.loader = loader; - this.errDispatcher = err; - beanTypes = new HashMap(); - } - - public void addBean(Node.UseBean n, String s, String type, String scope) - throws JasperException { - - if (!(scope == null || scope.equals("page") || scope.equals("request") - || scope.equals("session") || scope.equals("application"))) { - errDispatcher.jspError(n, "jsp.error.usebean.badScope"); - } - - beanTypes.put(s, type); - } - - public Class getBeanType(String bean) - throws JasperException { - Class clazz = null; - try { - clazz = loader.loadClass(beanTypes.get(bean)); - } catch (ClassNotFoundException ex) { - throw new JasperException (ex); - } - return clazz; - } - - public boolean checkVariable(String bean) { - return beanTypes.containsKey(bean); - } - -} - - - - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Collector.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Collector.java deleted file mode 100644 index 50b2b9de4..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Collector.java +++ /dev/null @@ -1,204 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import org.apache.jasper.JasperException; - -/** - * Collect info about the page and nodes, and make them availabe through - * the PageInfo object. - * - * @author Kin-man Chung - * @author Mark Roth - */ - -class Collector { - - /** - * A visitor for collecting information on the page and the body of - * the custom tags. - */ - static class CollectVisitor extends Node.Visitor { - - private boolean scriptingElementSeen = false; - private boolean usebeanSeen = false; - private boolean includeActionSeen = false; - private boolean paramActionSeen = false; - private boolean setPropertySeen = false; - private boolean hasScriptingVars = false; - - public void visit(Node.ParamAction n) throws JasperException { - if (n.getValue().isExpression()) { - scriptingElementSeen = true; - } - paramActionSeen = true; - } - - public void visit(Node.IncludeAction n) throws JasperException { - if (n.getPage().isExpression()) { - scriptingElementSeen = true; - } - includeActionSeen = true; - visitBody(n); - } - - public void visit(Node.ForwardAction n) throws JasperException { - if (n.getPage().isExpression()) { - scriptingElementSeen = true; - } - visitBody(n); - } - - public void visit(Node.SetProperty n) throws JasperException { - if (n.getValue() != null && n.getValue().isExpression()) { - scriptingElementSeen = true; - } - setPropertySeen = true; - } - - public void visit(Node.UseBean n) throws JasperException { - if (n.getBeanName() != null && n.getBeanName().isExpression()) { - scriptingElementSeen = true; - } - usebeanSeen = true; - visitBody(n); - } - - public void visit(Node.PlugIn n) throws JasperException { - if (n.getHeight() != null && n.getHeight().isExpression()) { - scriptingElementSeen = true; - } - if (n.getWidth() != null && n.getWidth().isExpression()) { - scriptingElementSeen = true; - } - visitBody(n); - } - - public void visit(Node.CustomTag n) throws JasperException { - // Check to see what kinds of element we see as child elements - checkSeen( n.getChildInfo(), n ); - } - - /** - * Check all child nodes for various elements and update the given - * ChildInfo object accordingly. Visits body in the process. - */ - private void checkSeen( Node.ChildInfo ci, Node n ) - throws JasperException - { - // save values collected so far - boolean scriptingElementSeenSave = scriptingElementSeen; - scriptingElementSeen = false; - boolean usebeanSeenSave = usebeanSeen; - usebeanSeen = false; - boolean includeActionSeenSave = includeActionSeen; - includeActionSeen = false; - boolean paramActionSeenSave = paramActionSeen; - paramActionSeen = false; - boolean setPropertySeenSave = setPropertySeen; - setPropertySeen = false; - boolean hasScriptingVarsSave = hasScriptingVars; - hasScriptingVars = false; - - // Scan attribute list for expressions - if( n instanceof Node.CustomTag ) { - Node.CustomTag ct = (Node.CustomTag)n; - Node.JspAttribute[] attrs = ct.getJspAttributes(); - for (int i = 0; attrs != null && i < attrs.length; i++) { - if (attrs[i].isExpression()) { - scriptingElementSeen = true; - break; - } - } - } - - visitBody(n); - - if( (n instanceof Node.CustomTag) && !hasScriptingVars) { - Node.CustomTag ct = (Node.CustomTag)n; - hasScriptingVars = ct.getVariableInfos().length > 0 || - ct.getTagVariableInfos().length > 0; - } - - // Record if the tag element and its body contains any scriptlet. - ci.setScriptless(! scriptingElementSeen); - ci.setHasUseBean(usebeanSeen); - ci.setHasIncludeAction(includeActionSeen); - ci.setHasParamAction(paramActionSeen); - ci.setHasSetProperty(setPropertySeen); - ci.setHasScriptingVars(hasScriptingVars); - - // Propagate value of scriptingElementSeen up. - scriptingElementSeen = scriptingElementSeen || scriptingElementSeenSave; - usebeanSeen = usebeanSeen || usebeanSeenSave; - setPropertySeen = setPropertySeen || setPropertySeenSave; - includeActionSeen = includeActionSeen || includeActionSeenSave; - paramActionSeen = paramActionSeen || paramActionSeenSave; - hasScriptingVars = hasScriptingVars || hasScriptingVarsSave; - } - - public void visit(Node.JspElement n) throws JasperException { - if (n.getNameAttribute().isExpression()) - scriptingElementSeen = true; - - Node.JspAttribute[] attrs = n.getJspAttributes(); - for (int i = 0; i < attrs.length; i++) { - if (attrs[i].isExpression()) { - scriptingElementSeen = true; - break; - } - } - visitBody(n); - } - - public void visit(Node.JspBody n) throws JasperException { - checkSeen( n.getChildInfo(), n ); - } - - public void visit(Node.NamedAttribute n) throws JasperException { - checkSeen( n.getChildInfo(), n ); - } - - public void visit(Node.Declaration n) throws JasperException { - scriptingElementSeen = true; - } - - public void visit(Node.Expression n) throws JasperException { - scriptingElementSeen = true; - } - - public void visit(Node.Scriptlet n) throws JasperException { - scriptingElementSeen = true; - } - - public void updatePageInfo(PageInfo pageInfo) { - pageInfo.setScriptless(! scriptingElementSeen); - } - } - - - public static void collect(Compiler compiler, Node.Nodes page) - throws JasperException { - - CollectVisitor collectVisitor = new CollectVisitor(); - page.visit(collectVisitor); - collectVisitor.updatePageInfo(compiler.getPageInfo()); - - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Compiler.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Compiler.java deleted file mode 100644 index 9a764f1d8..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Compiler.java +++ /dev/null @@ -1,551 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.File; -import java.io.FileNotFoundException; -import java.io.FileOutputStream; -import java.io.OutputStreamWriter; -import java.io.PrintWriter; -import java.io.UnsupportedEncodingException; -import java.net.JarURLConnection; -import java.net.URL; -import java.net.URLConnection; -import java.util.Iterator; -import java.util.List; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.Options; -import org.apache.jasper.servlet.JspServletWrapper; - -/** - * Main JSP compiler class. This class uses Ant for compiling. - * - * @author Anil K. Vijendran - * @author Mandar Raje - * @author Pierre Delisle - * @author Kin-man Chung - * @author Remy Maucherat - * @author Mark Roth - */ -public abstract class Compiler { - - protected org.apache.juli.logging.Log log = org.apache.juli.logging.LogFactory - .getLog(Compiler.class); - - // ----------------------------------------------------- Instance Variables - - protected JspCompilationContext ctxt; - - protected ErrorDispatcher errDispatcher; - - protected PageInfo pageInfo; - - protected JspServletWrapper jsw; - - protected TagFileProcessor tfp; - - protected Options options; - - protected Node.Nodes pageNodes; - - // ------------------------------------------------------------ Constructor - - public void init(JspCompilationContext ctxt, JspServletWrapper jsw) { - this.jsw = jsw; - this.ctxt = ctxt; - this.options = ctxt.getOptions(); - } - - // --------------------------------------------------------- Public Methods - - /** - *

- * Retrieves the parsed nodes of the JSP page, if they are available. May - * return null. Used in development mode for generating detailed error - * messages. http://issues.apache.org/bugzilla/show_bug.cgi?id=37062. - *

- */ - public Node.Nodes getPageNodes() { - return this.pageNodes; - } - - /** - * Compile the jsp file into equivalent servlet in .java file - * - * @return a smap for the current JSP page, if one is generated, null - * otherwise - */ - protected String[] generateJava() throws Exception { - - String[] smapStr = null; - - long t1, t2, t3, t4; - - t1 = t2 = t3 = t4 = 0; - - if (log.isDebugEnabled()) { - t1 = System.currentTimeMillis(); - } - - // Setup page info area - pageInfo = new PageInfo(new BeanRepository(ctxt.getClassLoader(), - errDispatcher), ctxt.getJspFile()); - - JspConfig jspConfig = options.getJspConfig(); - JspConfig.JspProperty jspProperty = jspConfig.findJspProperty(ctxt - .getJspFile()); - - /* - * If the current uri is matched by a pattern specified in a - * jsp-property-group in web.xml, initialize pageInfo with those - * properties. - */ - if (jspProperty.isELIgnored() != null) { - pageInfo.setELIgnored(JspUtil.booleanValue(jspProperty - .isELIgnored())); - } - if (jspProperty.isScriptingInvalid() != null) { - pageInfo.setScriptingInvalid(JspUtil.booleanValue(jspProperty - .isScriptingInvalid())); - } - if (jspProperty.getIncludePrelude() != null) { - pageInfo.setIncludePrelude(jspProperty.getIncludePrelude()); - } - if (jspProperty.getIncludeCoda() != null) { - pageInfo.setIncludeCoda(jspProperty.getIncludeCoda()); - } - if (jspProperty.isDeferedSyntaxAllowedAsLiteral() != null) { - pageInfo.setDeferredSyntaxAllowedAsLiteral(JspUtil.booleanValue(jspProperty - .isDeferedSyntaxAllowedAsLiteral())); - } - if (jspProperty.isTrimDirectiveWhitespaces() != null) { - pageInfo.setTrimDirectiveWhitespaces(JspUtil.booleanValue(jspProperty - .isTrimDirectiveWhitespaces())); - } - - ctxt.checkOutputDir(); - String javaFileName = ctxt.getServletJavaFileName(); - - ServletWriter writer = null; - try { - /* - * The setting of isELIgnored changes the behaviour of the parser - * in subtle ways. To add to the 'fun', isELIgnored can be set in - * any file that forms part of the translation unit so setting it - * in a file included towards the end of the translation unit can - * change how the parser should have behaved when parsing content - * up to the point where isELIgnored was set. Arghh! - * Previous attempts to hack around this have only provided partial - * solutions. We now use two passes to parse the translation unit. - * The first just parses the directives and the second parses the - * whole translation unit once we know how isELIgnored has been set. - * TODO There are some possible optimisations of this process. - */ - // Parse the file - ParserController parserCtl = new ParserController(ctxt, this); - - // Pass 1 - the directives - Node.Nodes directives = - parserCtl.parseDirectives(ctxt.getJspFile()); - Validator.validateDirectives(this, directives); - - // Pass 2 - the whole translation unit - pageNodes = parserCtl.parse(ctxt.getJspFile()); - - if (ctxt.isPrototypeMode()) { - // generate prototype .java file for the tag file - writer = setupContextWriter(javaFileName); - Generator.generate(writer, this, pageNodes); - writer.close(); - writer = null; - return null; - } - - // Validate and process attributes - don't re-validate the - // directives we validated in pass 1 - Validator.validateExDirectives(this, pageNodes); - - if (log.isDebugEnabled()) { - t2 = System.currentTimeMillis(); - } - - // Collect page info - Collector.collect(this, pageNodes); - - // Compile (if necessary) and load the tag files referenced in - // this compilation unit. - tfp = new TagFileProcessor(); - tfp.loadTagFiles(this, pageNodes); - - if (log.isDebugEnabled()) { - t3 = System.currentTimeMillis(); - } - - // Determine which custom tag needs to declare which scripting vars - ScriptingVariabler.set(pageNodes, errDispatcher); - - // Optimizations by Tag Plugins - TagPluginManager tagPluginManager = options.getTagPluginManager(); - tagPluginManager.apply(pageNodes, errDispatcher, pageInfo); - - // Optimization: concatenate contiguous template texts. - TextOptimizer.concatenate(this, pageNodes); - - // Generate static function mapper codes. - ELFunctionMapper.map(this, pageNodes); - - // generate servlet .java file - writer = setupContextWriter(javaFileName); - Generator.generate(writer, this, pageNodes); - writer.close(); - writer = null; - - // The writer is only used during the compile, dereference - // it in the JspCompilationContext when done to allow it - // to be GC'd and save memory. - ctxt.setWriter(null); - - if (log.isDebugEnabled()) { - t4 = System.currentTimeMillis(); - log.debug("Generated " + javaFileName + " total=" + (t4 - t1) - + " generate=" + (t4 - t3) + " validate=" + (t2 - t1)); - } - - } catch (Exception e) { - if (writer != null) { - try { - writer.close(); - writer = null; - } catch (Exception e1) { - // do nothing - } - } - // Remove the generated .java file - new File(javaFileName).delete(); - throw e; - } finally { - if (writer != null) { - try { - writer.close(); - } catch (Exception e2) { - // do nothing - } - } - } - - // JSR45 Support - if (!options.isSmapSuppressed()) { - smapStr = SmapUtil.generateSmap(ctxt, pageNodes); - } - - // If any proto type .java and .class files was generated, - // the prototype .java may have been replaced by the current - // compilation (if the tag file is self referencing), but the - // .class file need to be removed, to make sure that javac would - // generate .class again from the new .java file just generated. - tfp.removeProtoTypeFiles(ctxt.getClassFileName()); - - return smapStr; - } - - private ServletWriter setupContextWriter(String javaFileName) - throws FileNotFoundException, JasperException { - ServletWriter writer; - // Setup the ServletWriter - String javaEncoding = ctxt.getOptions().getJavaEncoding(); - OutputStreamWriter osw = null; - - try { - osw = new OutputStreamWriter( - new FileOutputStream(javaFileName), javaEncoding); - } catch (UnsupportedEncodingException ex) { - errDispatcher.jspError("jsp.error.needAlternateJavaEncoding", - javaEncoding); - } - - writer = new ServletWriter(new PrintWriter(osw)); - ctxt.setWriter(writer); - return writer; - } - - /** - * Compile the servlet from .java file to .class file - */ - protected abstract void generateClass(String[] smap) - throws FileNotFoundException, JasperException, Exception; - - /** - * Compile the jsp file from the current engine context - */ - public void compile() throws FileNotFoundException, JasperException, - Exception { - compile(true); - } - - /** - * Compile the jsp file from the current engine context. As an side- effect, - * tag files that are referenced by this page are also compiled. - * - * @param compileClass - * If true, generate both .java and .class file If false, - * generate only .java file - */ - public void compile(boolean compileClass) throws FileNotFoundException, - JasperException, Exception { - compile(compileClass, false); - } - - /** - * Compile the jsp file from the current engine context. As an side- effect, - * tag files that are referenced by this page are also compiled. - * - * @param compileClass - * If true, generate both .java and .class file If false, - * generate only .java file - * @param jspcMode - * true if invoked from JspC, false otherwise - */ - public void compile(boolean compileClass, boolean jspcMode) - throws FileNotFoundException, JasperException, Exception { - if (errDispatcher == null) { - this.errDispatcher = new ErrorDispatcher(jspcMode); - } - - try { - String[] smap = generateJava(); - if (compileClass) { - generateClass(smap); - // Fix for bugzilla 41606 - // Set JspServletWrapper.servletClassLastModifiedTime after successful compile - String targetFileName = ctxt.getClassFileName(); - if (targetFileName != null) { - File targetFile = new File(targetFileName); - if (targetFile.exists() && jsw != null) { - jsw.setServletClassLastModifiedTime(targetFile.lastModified()); - } - } - } - } finally { - if (tfp != null && ctxt.isPrototypeMode()) { - tfp.removeProtoTypeFiles(null); - } - // Make sure these object which are only used during the - // generation and compilation of the JSP page get - // dereferenced so that they can be GC'd and reduce the - // memory footprint. - tfp = null; - errDispatcher = null; - pageInfo = null; - - // Only get rid of the pageNodes if in production. - // In development mode, they are used for detailed - // error messages. - // http://issues.apache.org/bugzilla/show_bug.cgi?id=37062 - if (!this.options.getDevelopment()) { - pageNodes = null; - } - - if (ctxt.getWriter() != null) { - ctxt.getWriter().close(); - ctxt.setWriter(null); - } - } - } - - /** - * This is a protected method intended to be overridden by subclasses of - * Compiler. This is used by the compile method to do all the compilation. - */ - public boolean isOutDated() { - return isOutDated(true); - } - - /** - * Determine if a compilation is necessary by checking the time stamp of the - * JSP page with that of the corresponding .class or .java file. If the page - * has dependencies, the check is also extended to its dependeants, and so - * on. This method can by overidden by a subclasses of Compiler. - * - * @param checkClass - * If true, check against .class file, if false, check against - * .java file. - */ - public boolean isOutDated(boolean checkClass) { - - String jsp = ctxt.getJspFile(); - - if (jsw != null - && (ctxt.getOptions().getModificationTestInterval() > 0)) { - - if (jsw.getLastModificationTest() - + (ctxt.getOptions().getModificationTestInterval() * 1000) > System - .currentTimeMillis()) { - return false; - } else { - jsw.setLastModificationTest(System.currentTimeMillis()); - } - } - - long jspRealLastModified = 0; - try { - URL jspUrl = ctxt.getResource(jsp); - if (jspUrl == null) { - ctxt.incrementRemoved(); - return false; - } - URLConnection uc = jspUrl.openConnection(); - if (uc instanceof JarURLConnection) { - jspRealLastModified = - ((JarURLConnection) uc).getJarEntry().getTime(); - } else { - jspRealLastModified = uc.getLastModified(); - } - uc.getInputStream().close(); - } catch (Exception e) { - return true; - } - - long targetLastModified = 0; - File targetFile; - - if (checkClass) { - targetFile = new File(ctxt.getClassFileName()); - } else { - targetFile = new File(ctxt.getServletJavaFileName()); - } - - if (!targetFile.exists()) { - return true; - } - - targetLastModified = targetFile.lastModified(); - if (checkClass && jsw != null) { - jsw.setServletClassLastModifiedTime(targetLastModified); - } - if (targetLastModified < jspRealLastModified) { - if (log.isDebugEnabled()) { - log.debug("Compiler: outdated: " + targetFile + " " - + targetLastModified); - } - return true; - } - - // determine if source dependent files (e.g. includes using include - // directives) have been changed. - if (jsw == null) { - return false; - } - - List depends = jsw.getDependants(); - if (depends == null) { - return false; - } - - Iterator it = depends.iterator(); - while (it.hasNext()) { - String include = (String) it.next(); - try { - URL includeUrl = ctxt.getResource(include); - if (includeUrl == null) { - return true; - } - - URLConnection iuc = includeUrl.openConnection(); - long includeLastModified = 0; - if (iuc instanceof JarURLConnection) { - includeLastModified = - ((JarURLConnection) iuc).getJarEntry().getTime(); - } else { - includeLastModified = iuc.getLastModified(); - } - iuc.getInputStream().close(); - - if (includeLastModified > targetLastModified) { - return true; - } - } catch (Exception e) { - return true; - } - } - - return false; - - } - - /** - * Gets the error dispatcher. - */ - public ErrorDispatcher getErrorDispatcher() { - return errDispatcher; - } - - /** - * Gets the info about the page under compilation - */ - public PageInfo getPageInfo() { - return pageInfo; - } - - public JspCompilationContext getCompilationContext() { - return ctxt; - } - - /** - * Remove generated files - */ - public void removeGeneratedFiles() { - try { - String classFileName = ctxt.getClassFileName(); - if (classFileName != null) { - File classFile = new File(classFileName); - if (log.isDebugEnabled()) - log.debug("Deleting " + classFile); - classFile.delete(); - } - } catch (Exception e) { - // Remove as much as possible, ignore possible exceptions - } - try { - String javaFileName = ctxt.getServletJavaFileName(); - if (javaFileName != null) { - File javaFile = new File(javaFileName); - if (log.isDebugEnabled()) - log.debug("Deleting " + javaFile); - javaFile.delete(); - } - } catch (Exception e) { - // Remove as much as possible, ignore possible exceptions - } - } - - public void removeGeneratedClassFiles() { - try { - String classFileName = ctxt.getClassFileName(); - if (classFileName != null) { - File classFile = new File(classFileName); - if (log.isDebugEnabled()) - log.debug("Deleting " + classFile); - classFile.delete(); - } - } catch (Exception e) { - // Remove as much as possible, ignore possible exceptions - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/DefaultErrorHandler.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/DefaultErrorHandler.java deleted file mode 100644 index 97d543c02..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/DefaultErrorHandler.java +++ /dev/null @@ -1,109 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import org.apache.jasper.JasperException; - -/** - * Default implementation of ErrorHandler interface. - * - * @author Jan Luehe - */ -class DefaultErrorHandler implements ErrorHandler { - - /* - * Processes the given JSP parse error. - * - * @param fname Name of the JSP file in which the parse error occurred - * @param line Parse error line number - * @param column Parse error column number - * @param errMsg Parse error message - * @param exception Parse exception - */ - public void jspError(String fname, int line, int column, String errMsg, - Exception ex) throws JasperException { - throw new JasperException(fname + "(" + line + "," + column + ")" - + " " + errMsg, ex); - } - - /* - * Processes the given JSP parse error. - * - * @param errMsg Parse error message - * @param exception Parse exception - */ - public void jspError(String errMsg, Exception ex) throws JasperException { - throw new JasperException(errMsg, ex); - } - - /* - * Processes the given javac compilation errors. - * - * @param details Array of JavacErrorDetail instances corresponding to the - * compilation errors - */ - public void javacError(JavacErrorDetail[] details) throws JasperException { - - if (details == null) { - return; - } - - Object[] args = null; - StringBuffer buf = new StringBuffer(); - - for (int i=0; i < details.length; i++) { - if (details[i].getJspBeginLineNumber() >= 0) { - args = new Object[] { - new Integer(details[i].getJspBeginLineNumber()), - details[i].getJspFileName() }; - buf.append("\n\n"); - buf.append(Localizer.getMessage("jsp.error.single.line.number", - args)); - buf.append("\n"); - buf.append(details[i].getErrorMessage()); - buf.append("\n"); - buf.append(details[i].getJspExtract()); - } else { - args = new Object[] { - new Integer(details[i].getJavaLineNumber()) }; - buf.append("\n\n"); - buf.append(Localizer.getMessage("jsp.error.java.line.number", - args)); - buf.append("\n"); - buf.append(details[i].getErrorMessage()); - } - } - buf.append("\n\nStacktrace:"); - throw new JasperException( - Localizer.getMessage("jsp.error.unable.compile") + ": " + buf); - } - - /** - * Processes the given javac error report and exception. - * - * @param errorReport Compilation error report - * @param exception Compilation exception - */ - public void javacError(String errorReport, Exception exception) - throws JasperException { - - throw new JasperException( - Localizer.getMessage("jsp.error.unable.compile"), exception); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Dumper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Dumper.java deleted file mode 100644 index 1925f55d3..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Dumper.java +++ /dev/null @@ -1,207 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import org.xml.sax.Attributes; -import org.apache.jasper.JasperException; - -class Dumper { - - static class DumpVisitor extends Node.Visitor { - private int indent = 0; - - private String getAttributes(Attributes attrs) { - if (attrs == null) - return ""; - - StringBuffer buf = new StringBuffer(); - for (int i=0; i < attrs.getLength(); i++) { - buf.append(" " + attrs.getQName(i) + "=\"" - + attrs.getValue(i) + "\""); - } - return buf.toString(); - } - - private void printString(String str) { - printIndent(); - System.out.print(str); - } - - private void printString(String prefix, char[] chars, String suffix) { - String str = null; - if (chars != null) { - str = new String(chars); - } - printString(prefix, str, suffix); - } - - private void printString(String prefix, String str, String suffix) { - printIndent(); - if (str != null) { - System.out.print(prefix + str + suffix); - } else { - System.out.print(prefix + suffix); - } - } - - private void printAttributes(String prefix, Attributes attrs, - String suffix) { - printString(prefix, getAttributes(attrs), suffix); - } - - private void dumpBody(Node n) throws JasperException { - Node.Nodes page = n.getBody(); - if (page != null) { -// indent++; - page.visit(this); -// indent--; - } - } - - public void visit(Node.PageDirective n) throws JasperException { - printAttributes("<%@ page", n.getAttributes(), "%>"); - } - - public void visit(Node.TaglibDirective n) throws JasperException { - printAttributes("<%@ taglib", n.getAttributes(), "%>"); - } - - public void visit(Node.IncludeDirective n) throws JasperException { - printAttributes("<%@ include", n.getAttributes(), "%>"); - dumpBody(n); - } - - public void visit(Node.Comment n) throws JasperException { - printString("<%--", n.getText(), "--%>"); - } - - public void visit(Node.Declaration n) throws JasperException { - printString("<%!", n.getText(), "%>"); - } - - public void visit(Node.Expression n) throws JasperException { - printString("<%=", n.getText(), "%>"); - } - - public void visit(Node.Scriptlet n) throws JasperException { - printString("<%", n.getText(), "%>"); - } - - public void visit(Node.IncludeAction n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.ForwardAction n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.GetProperty n) throws JasperException { - printAttributes(""); - } - - public void visit(Node.SetProperty n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.UseBean n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.PlugIn n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.ParamsAction n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.ParamAction n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.NamedAttribute n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.JspBody n) throws JasperException { - printAttributes(""); - dumpBody(n); - printString(""); - } - - public void visit(Node.ELExpression n) throws JasperException { - printString( "${" + new String( n.getText() ) + "}" ); - } - - public void visit(Node.CustomTag n) throws JasperException { - printAttributes("<" + n.getQName(), n.getAttributes(), ">"); - dumpBody(n); - printString(""); - } - - public void visit(Node.UninterpretedTag n) throws JasperException { - String tag = n.getQName(); - printAttributes("<"+tag, n.getAttributes(), ">"); - dumpBody(n); - printString(""); - } - - public void visit(Node.TemplateText n) throws JasperException { - printString(new String(n.getText())); - } - - private void printIndent() { - for (int i=0; i < indent; i++) { - System.out.print(" "); - } - } - } - - public static void dump(Node n) { - try { - n.accept(new DumpVisitor()); - } catch (JasperException e) { - e.printStackTrace(); - } - } - - public static void dump(Node.Nodes page) { - try { - page.visit(new DumpVisitor()); - } catch (JasperException e) { - e.printStackTrace(); - } - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELFunctionMapper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELFunctionMapper.java deleted file mode 100644 index f2df33dc0..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELFunctionMapper.java +++ /dev/null @@ -1,281 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.util.*; -import javax.servlet.jsp.tagext.FunctionInfo; -import org.apache.jasper.JasperException; - -/** - * This class generates functions mappers for the EL expressions in the page. - * Instead of a global mapper, a mapper is used for ecah call to EL - * evaluator, thus avoiding the prefix overlapping and redefinition - * issues. - * - * @author Kin-man Chung - */ - -public class ELFunctionMapper { - private int currFunc = 0; - StringBuffer ds; // Contains codes to initialize the functions mappers. - StringBuffer ss; // Contains declarations of the functions mappers. - - /** - * Creates the functions mappers for all EL expressions in the JSP page. - * - * @param compiler Current compiler, mainly for accessing error dispatcher. - * @param page The current compilation unit. - */ - public static void map(Compiler compiler, Node.Nodes page) - throws JasperException { - - ELFunctionMapper map = new ELFunctionMapper(); - map.ds = new StringBuffer(); - map.ss = new StringBuffer(); - - page.visit(map.new ELFunctionVisitor()); - - // Append the declarations to the root node - String ds = map.ds.toString(); - if (ds.length() > 0) { - Node root = page.getRoot(); - new Node.Declaration(map.ss.toString(), null, root); - new Node.Declaration("static {\n" + ds + "}\n", null, root); - } - } - - /** - * A visitor for the page. The places where EL is allowed are scanned - * for functions, and if found functions mappers are created. - */ - class ELFunctionVisitor extends Node.Visitor { - - /** - * Use a global name map to facilitate reuse of function maps. - * The key used is prefix:function:uri. - */ - private HashMap gMap = new HashMap(); - - public void visit(Node.ParamAction n) throws JasperException { - doMap(n.getValue()); - visitBody(n); - } - - public void visit(Node.IncludeAction n) throws JasperException { - doMap(n.getPage()); - visitBody(n); - } - - public void visit(Node.ForwardAction n) throws JasperException { - doMap(n.getPage()); - visitBody(n); - } - - public void visit(Node.SetProperty n) throws JasperException { - doMap(n.getValue()); - visitBody(n); - } - - public void visit(Node.UseBean n) throws JasperException { - doMap(n.getBeanName()); - visitBody(n); - } - - public void visit(Node.PlugIn n) throws JasperException { - doMap(n.getHeight()); - doMap(n.getWidth()); - visitBody(n); - } - - public void visit(Node.JspElement n) throws JasperException { - - Node.JspAttribute[] attrs = n.getJspAttributes(); - for (int i = 0; attrs != null && i < attrs.length; i++) { - doMap(attrs[i]); - } - doMap(n.getNameAttribute()); - visitBody(n); - } - - public void visit(Node.UninterpretedTag n) throws JasperException { - - Node.JspAttribute[] attrs = n.getJspAttributes(); - for (int i = 0; attrs != null && i < attrs.length; i++) { - doMap(attrs[i]); - } - visitBody(n); - } - - public void visit(Node.CustomTag n) throws JasperException { - Node.JspAttribute[] attrs = n.getJspAttributes(); - for (int i = 0; attrs != null && i < attrs.length; i++) { - doMap(attrs[i]); - } - visitBody(n); - } - - public void visit(Node.ELExpression n) throws JasperException { - doMap(n.getEL()); - } - - private void doMap(Node.JspAttribute attr) - throws JasperException { - if (attr != null) { - doMap(attr.getEL()); - } - } - - /** - * Creates function mappers, if needed, from ELNodes - */ - private void doMap(ELNode.Nodes el) - throws JasperException { - - // Only care about functions in ELNode's - class Fvisitor extends ELNode.Visitor { - ArrayList funcs = - new ArrayList(); - HashMap keyMap = new HashMap(); - public void visit(ELNode.Function n) throws JasperException { - String key = n.getPrefix() + ":" + n.getName(); - if (! keyMap.containsKey(key)) { - keyMap.put(key,""); - funcs.add(n); - } - } - } - - if (el == null) { - return; - } - - // First locate all unique functions in this EL - Fvisitor fv = new Fvisitor(); - el.visit(fv); - ArrayList functions = fv.funcs; - - if (functions.size() == 0) { - return; - } - - // Reuse a previous map if possible - String decName = matchMap(functions); - if (decName != null) { - el.setMapName(decName); - return; - } - - // Generate declaration for the map statically - decName = getMapName(); - ss.append("static private org.apache.jasper.runtime.ProtectedFunctionMapper " + decName + ";\n"); - - ds.append(" " + decName + "= "); - ds.append("org.apache.jasper.runtime.ProtectedFunctionMapper"); - - // Special case if there is only one function in the map - String funcMethod = null; - if (functions.size() == 1) { - funcMethod = ".getMapForFunction"; - } else { - ds.append(".getInstance();\n"); - funcMethod = " " + decName + ".mapFunction"; - } - - // Setup arguments for either getMapForFunction or mapFunction - for (int i = 0; i < functions.size(); i++) { - ELNode.Function f = (ELNode.Function)functions.get(i); - FunctionInfo funcInfo = f.getFunctionInfo(); - String key = f.getPrefix()+ ":" + f.getName(); - ds.append(funcMethod + "(\"" + key + "\", " + - funcInfo.getFunctionClass() + ".class, " + - '\"' + f.getMethodName() + "\", " + - "new Class[] {"); - String params[] = f.getParameters(); - for (int k = 0; k < params.length; k++) { - if (k != 0) { - ds.append(", "); - } - int iArray = params[k].indexOf('['); - if (iArray < 0) { - ds.append(params[k] + ".class"); - } - else { - String baseType = params[k].substring(0, iArray); - ds.append("java.lang.reflect.Array.newInstance("); - ds.append(baseType); - ds.append(".class,"); - - // Count the number of array dimension - int aCount = 0; - for (int jj = iArray; jj < params[k].length(); jj++ ) { - if (params[k].charAt(jj) == '[') { - aCount++; - } - } - if (aCount == 1) { - ds.append("0).getClass()"); - } else { - ds.append("new int[" + aCount + "]).getClass()"); - } - } - } - ds.append("});\n"); - // Put the current name in the global function map - gMap.put(f.getPrefix() + ':' + f.getName() + ':' + f.getUri(), - decName); - } - el.setMapName(decName); - } - - /** - * Find the name of the function mapper for an EL. Reuse a - * previously generated one if possible. - * @param functions An ArrayList of ELNode.Function instances that - * represents the functions in an EL - * @return A previous generated function mapper name that can be used - * by this EL; null if none found. - */ - private String matchMap(ArrayList functions) { - - String mapName = null; - for (int i = 0; i < functions.size(); i++) { - ELNode.Function f = (ELNode.Function)functions.get(i); - String temName = (String) gMap.get(f.getPrefix() + ':' + - f.getName() + ':' + f.getUri()); - if (temName == null) { - return null; - } - if (mapName == null) { - mapName = temName; - } else if (!temName.equals(mapName)) { - // If not all in the previous match, then no match. - return null; - } - } - return mapName; - } - - /* - * @return An unique name for a function mapper. - */ - private String getMapName() { - return "_jspx_fnmap_" + currFunc++; - } - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELNode.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELNode.java deleted file mode 100644 index 3ee629e94..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELNode.java +++ /dev/null @@ -1,255 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.util.*; -import javax.servlet.jsp.tagext.FunctionInfo; -import org.apache.jasper.JasperException; - -/** - * This class defines internal representation for an EL Expression - * - * It currently only defines functions. It can be expanded to define - * all the components of an EL expression, if need to. - * - * @author Kin-man Chung - */ - -abstract class ELNode { - - abstract public void accept(Visitor v) throws JasperException; - - /** - * Child classes - */ - - - /** - * Represents an EL expression: anything in ${ and }. - */ - public static class Root extends ELNode { - - private ELNode.Nodes expr; - private char type; - - Root(ELNode.Nodes expr, char type) { - this.expr = expr; - this.type = type; - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public ELNode.Nodes getExpression() { - return expr; - } - - public char getType() { - return type; - } - } - - /** - * Represents text outside of EL expression. - */ - public static class Text extends ELNode { - - private String text; - - Text(String text) { - this.text = text; - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public String getText() { - return text; - } - } - - /** - * Represents anything in EL expression, other than functions, including - * function arguments etc - */ - public static class ELText extends ELNode { - - private String text; - - ELText(String text) { - this.text = text; - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public String getText() { - return text; - } - } - - /** - * Represents a function - * Currently only include the prefix and function name, but not its - * arguments. - */ - public static class Function extends ELNode { - - private String prefix; - private String name; - private String uri; - private FunctionInfo functionInfo; - private String methodName; - private String[] parameters; - - Function(String prefix, String name) { - this.prefix = prefix; - this.name = name; - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public String getPrefix() { - return prefix; - } - - public String getName() { - return name; - } - - public void setUri(String uri) { - this.uri = uri; - } - - public String getUri() { - return uri; - } - - public void setFunctionInfo(FunctionInfo f) { - this.functionInfo = f; - } - - public FunctionInfo getFunctionInfo() { - return functionInfo; - } - - public void setMethodName(String methodName) { - this.methodName = methodName; - } - - public String getMethodName() { - return methodName; - } - - public void setParameters(String[] parameters) { - this.parameters = parameters; - } - - public String[] getParameters() { - return parameters; - } - } - - /** - * An ordered list of ELNode. - */ - public static class Nodes { - - /* Name used for creating a map for the functions in this - EL expression, for communication to Generator. - */ - String mapName = null; // The function map associated this EL - private List list; - - public Nodes() { - list = new ArrayList(); - } - - public void add(ELNode en) { - list.add(en); - } - - /** - * Visit the nodes in the list with the supplied visitor - * @param v The visitor used - */ - public void visit(Visitor v) throws JasperException { - Iterator iter = list.iterator(); - while (iter.hasNext()) { - ELNode n = iter.next(); - n.accept(v); - } - } - - public Iterator iterator() { - return list.iterator(); - } - - public boolean isEmpty() { - return list.size() == 0; - } - - /** - * @return true if the expression contains a ${...} - */ - public boolean containsEL() { - Iterator iter = list.iterator(); - while (iter.hasNext()) { - ELNode n = iter.next(); - if (n instanceof Root) { - return true; - } - } - return false; - } - - public void setMapName(String name) { - this.mapName = name; - } - - public String getMapName() { - return mapName; - } - - } - - /* - * A visitor class for traversing ELNodes - */ - public static class Visitor { - - public void visit(Root n) throws JasperException { - n.getExpression().visit(this); - } - - public void visit(Function n) throws JasperException { - } - - public void visit(Text n) throws JasperException { - } - - public void visit(ELText n) throws JasperException { - } - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELParser.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELParser.java deleted file mode 100644 index e8cba0221..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ELParser.java +++ /dev/null @@ -1,382 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -/** - * This class implements a parser for EL expressions. - * - * It takes strings of the form xxx${..}yyy${..}zzz etc, and turn it into a - * ELNode.Nodes. - * - * Currently, it only handles text outside ${..} and functions in ${ ..}. - * - * @author Kin-man Chung - */ - -public class ELParser { - - private Token curToken; // current token - - private ELNode.Nodes expr; - - private ELNode.Nodes ELexpr; - - private int index; // Current index of the expression - - private String expression; // The EL expression - - private char type; - - private boolean escapeBS; // is '\' an escape char in text outside EL? - - private static final String reservedWords[] = { "and", "div", "empty", - "eq", "false", "ge", "gt", "instanceof", "le", "lt", "mod", "ne", - "not", "null", "or", "true" }; - - public ELParser(String expression) { - index = 0; - this.expression = expression; - expr = new ELNode.Nodes(); - } - - /** - * Parse an EL expression - * - * @param expression - * The input expression string of the form Char* ('${' Char* - * '}')* Char* - * @return Parsed EL expression in ELNode.Nodes - */ - public static ELNode.Nodes parse(String expression) { - ELParser parser = new ELParser(expression); - while (parser.hasNextChar()) { - String text = parser.skipUntilEL(); - if (text.length() > 0) { - parser.expr.add(new ELNode.Text(text)); - } - ELNode.Nodes elexpr = parser.parseEL(); - if (!elexpr.isEmpty()) { - parser.expr.add(new ELNode.Root(elexpr, parser.type)); - } - } - return parser.expr; - } - - /** - * Parse an EL expression string '${...}' - * - * @return An ELNode.Nodes representing the EL expression TODO: Currently - * only parsed into functions and text strings. This should be - * rewritten for a full parser. - */ - private ELNode.Nodes parseEL() { - - StringBuffer buf = new StringBuffer(); - ELexpr = new ELNode.Nodes(); - while (hasNext()) { - curToken = nextToken(); - if (curToken instanceof Char) { - if (curToken.toChar() == '}') { - break; - } - buf.append(curToken.toChar()); - } else { - // Output whatever is in buffer - if (buf.length() > 0) { - ELexpr.add(new ELNode.ELText(buf.toString())); - } - if (!parseFunction()) { - ELexpr.add(new ELNode.ELText(curToken.toString())); - } - } - } - if (buf.length() > 0) { - ELexpr.add(new ELNode.ELText(buf.toString())); - } - - return ELexpr; - } - - /** - * Parse for a function FunctionInvokation ::= (identifier ':')? identifier - * '(' (Expression (,Expression)*)? ')' Note: currently we don't parse - * arguments - */ - private boolean parseFunction() { - if (!(curToken instanceof Id) || isELReserved(curToken.toString())) { - return false; - } - String s1 = null; // Function prefix - String s2 = curToken.toString(); // Function name - int mark = getIndex(); - if (hasNext()) { - Token t = nextToken(); - if (t.toChar() == ':') { - if (hasNext()) { - Token t2 = nextToken(); - if (t2 instanceof Id) { - s1 = s2; - s2 = t2.toString(); - if (hasNext()) { - t = nextToken(); - } - } - } - } - if (t.toChar() == '(') { - ELexpr.add(new ELNode.Function(s1, s2)); - return true; - } - } - setIndex(mark); - return false; - } - - /** - * Test if an id is a reserved word in EL - */ - private boolean isELReserved(String id) { - int i = 0; - int j = reservedWords.length; - while (i < j) { - int k = (i + j) / 2; - int result = reservedWords[k].compareTo(id); - if (result == 0) { - return true; - } - if (result < 0) { - i = k + 1; - } else { - j = k; - } - } - return false; - } - - /** - * Skip until an EL expression ('${' || '#{') is reached, allowing escape - * sequences '\\' and '\$' and '\#'. - * - * @return The text string up to the EL expression - */ - private String skipUntilEL() { - char prev = 0; - StringBuffer buf = new StringBuffer(); - while (hasNextChar()) { - char ch = nextChar(); - if (prev == '\\') { - prev = 0; - if (ch == '\\') { - buf.append('\\'); - if (!escapeBS) - prev = '\\'; - } else if (ch == '$' || ch == '#') { - buf.append(ch); - } - // else error! - } else if (prev == '$' || prev == '#') { - if (ch == '{') { - this.type = prev; - prev = 0; - break; - } - buf.append(prev); - prev = 0; - } - if (ch == '\\' || ch == '$' || ch == '#') { - prev = ch; - } else { - buf.append(ch); - } - } - if (prev != 0) { - buf.append(prev); - } - return buf.toString(); - } - - /* - * @return true if there is something left in EL expression buffer other - * than white spaces. - */ - private boolean hasNext() { - skipSpaces(); - return hasNextChar(); - } - - /* - * @return The next token in the EL expression buffer. - */ - private Token nextToken() { - skipSpaces(); - if (hasNextChar()) { - char ch = nextChar(); - if (Character.isJavaIdentifierStart(ch)) { - StringBuffer buf = new StringBuffer(); - buf.append(ch); - while ((ch = peekChar()) != -1 - && Character.isJavaIdentifierPart(ch)) { - buf.append(ch); - nextChar(); - } - return new Id(buf.toString()); - } - - if (ch == '\'' || ch == '"') { - return parseQuotedChars(ch); - } else { - // For now... - return new Char(ch); - } - } - return null; - } - - /* - * Parse a string in single or double quotes, allowing for escape sequences - * '\\', and ('\"', or "\'") - */ - private Token parseQuotedChars(char quote) { - StringBuffer buf = new StringBuffer(); - buf.append(quote); - while (hasNextChar()) { - char ch = nextChar(); - if (ch == '\\') { - ch = nextChar(); - if (ch == '\\' || ch == quote) { - buf.append(ch); - } - // else error! - } else if (ch == quote) { - buf.append(ch); - break; - } else { - buf.append(ch); - } - } - return new QuotedString(buf.toString()); - } - - /* - * A collection of low level parse methods dealing with character in the EL - * expression buffer. - */ - - private void skipSpaces() { - while (hasNextChar()) { - if (expression.charAt(index) > ' ') - break; - index++; - } - } - - private boolean hasNextChar() { - return index < expression.length(); - } - - private char nextChar() { - if (index >= expression.length()) { - return (char) -1; - } - return expression.charAt(index++); - } - - private char peekChar() { - if (index >= expression.length()) { - return (char) -1; - } - return expression.charAt(index); - } - - private int getIndex() { - return index; - } - - private void setIndex(int i) { - index = i; - } - - /* - * Represents a token in EL expression string - */ - private static class Token { - - char toChar() { - return 0; - } - - public String toString() { - return ""; - } - } - - /* - * Represents an ID token in EL - */ - private static class Id extends Token { - String id; - - Id(String id) { - this.id = id; - } - - public String toString() { - return id; - } - } - - /* - * Represents a character token in EL - */ - private static class Char extends Token { - - private char ch; - - Char(char ch) { - this.ch = ch; - } - - char toChar() { - return ch; - } - - public String toString() { - return (new Character(ch)).toString(); - } - } - - /* - * Represents a quoted (single or double) string token in EL - */ - private static class QuotedString extends Token { - - private String value; - - QuotedString(String v) { - this.value = v; - } - - public String toString() { - return value; - } - } - - public char getType() { - return type; - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ErrorDispatcher.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ErrorDispatcher.java deleted file mode 100644 index b4872c4d3..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ErrorDispatcher.java +++ /dev/null @@ -1,615 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import java.io.BufferedReader; -import java.io.IOException; -import java.io.StringReader; -import java.net.MalformedURLException; -import java.util.ArrayList; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.xml.sax.SAXException; - -/** - * Class responsible for dispatching JSP parse and javac compilation errors - * to the configured error handler. - * - * This class is also responsible for localizing any error codes before they - * are passed on to the configured error handler. - * - * In the case of a Java compilation error, the compiler error message is - * parsed into an array of JavacErrorDetail instances, which is passed on to - * the configured error handler. - * - * @author Jan Luehe - * @author Kin-man Chung - */ -public class ErrorDispatcher { - - // Custom error handler - private ErrorHandler errHandler; - - // Indicates whether the compilation was initiated by JspServlet or JspC - private boolean jspcMode = false; - - - /* - * Constructor. - * - * @param jspcMode true if compilation has been initiated by JspC, false - * otherwise - */ - public ErrorDispatcher(boolean jspcMode) { - // XXX check web.xml for custom error handler - errHandler = new DefaultErrorHandler(); - this.jspcMode = jspcMode; - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param errCode Error code - */ - public void jspError(String errCode) throws JasperException { - dispatch(null, errCode, null, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param where Error location - * @param errCode Error code - */ - public void jspError(Mark where, String errCode) throws JasperException { - dispatch(where, errCode, null, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param n Node that caused the error - * @param errCode Error code - */ - public void jspError(Node n, String errCode) throws JasperException { - dispatch(n.getStart(), errCode, null, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param errCode Error code - * @param arg Argument for parametric replacement - */ - public void jspError(String errCode, String arg) throws JasperException { - dispatch(null, errCode, new Object[] {arg}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param where Error location - * @param errCode Error code - * @param arg Argument for parametric replacement - */ - public void jspError(Mark where, String errCode, String arg) - throws JasperException { - dispatch(where, errCode, new Object[] {arg}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param n Node that caused the error - * @param errCode Error code - * @param arg Argument for parametric replacement - */ - public void jspError(Node n, String errCode, String arg) - throws JasperException { - dispatch(n.getStart(), errCode, new Object[] {arg}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param errCode Error code - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - */ - public void jspError(String errCode, String arg1, String arg2) - throws JasperException { - dispatch(null, errCode, new Object[] {arg1, arg2}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param errCode Error code - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - * @param arg3 Third argument for parametric replacement - */ - public void jspError(String errCode, String arg1, String arg2, String arg3) - throws JasperException { - dispatch(null, errCode, new Object[] {arg1, arg2, arg3}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param where Error location - * @param errCode Error code - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - */ - public void jspError(Mark where, String errCode, String arg1, String arg2) - throws JasperException { - dispatch(where, errCode, new Object[] {arg1, arg2}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param where Error location - * @param errCode Error code - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - * @param arg3 Third argument for parametric replacement - */ - - public void jspError(Mark where, String errCode, String arg1, String arg2, - String arg3) - throws JasperException { - dispatch(where, errCode, new Object[] {arg1, arg2, arg3}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param n Node that caused the error - * @param errCode Error code - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - */ - - public void jspError(Node n, String errCode, String arg1, String arg2) - throws JasperException { - dispatch(n.getStart(), errCode, new Object[] {arg1, arg2}, null); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param n Node that caused the error - * @param errCode Error code - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - * @param arg3 Third argument for parametric replacement - */ - - public void jspError(Node n, String errCode, String arg1, String arg2, - String arg3) - throws JasperException { - dispatch(n.getStart(), errCode, new Object[] {arg1, arg2, arg3}, null); - } - - /* - * Dispatches the given parsing exception to the configured error handler. - * - * @param e Parsing exception - */ - public void jspError(Exception e) throws JasperException { - dispatch(null, null, null, e); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param errCode Error code - * @param arg Argument for parametric replacement - * @param e Parsing exception - */ - public void jspError(String errCode, String arg, Exception e) - throws JasperException { - dispatch(null, errCode, new Object[] {arg}, e); - } - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param n Node that caused the error - * @param errCode Error code - * @param arg Argument for parametric replacement - * @param e Parsing exception - */ - public void jspError(Node n, String errCode, String arg, Exception e) - throws JasperException { - dispatch(n.getStart(), errCode, new Object[] {arg}, e); - } - - /** - * Parses the given error message into an array of javac compilation error - * messages (one per javac compilation error line number). - * - * @param errMsg Error message - * @param fname Name of Java source file whose compilation failed - * @param page Node representation of JSP page from which the Java source - * file was generated - * - * @return Array of javac compilation errors, or null if the given error - * message does not contain any compilation error line numbers - */ - public static JavacErrorDetail[] parseJavacErrors(String errMsg, - String fname, - Node.Nodes page) - throws JasperException, IOException { - - return parseJavacMessage(errMsg, fname, page); - } - - /* - * Dispatches the given javac compilation errors to the configured error - * handler. - * - * @param javacErrors Array of javac compilation errors - */ - public void javacError(JavacErrorDetail[] javacErrors) - throws JasperException { - - errHandler.javacError(javacErrors); - } - - - /* - * Dispatches the given compilation error report and exception to the - * configured error handler. - * - * @param errorReport Compilation error report - * @param e Compilation exception - */ - public void javacError(String errorReport, Exception e) - throws JasperException { - - errHandler.javacError(errorReport, e); - } - - - //********************************************************************* - // Private utility methods - - /* - * Dispatches the given JSP parse error to the configured error handler. - * - * The given error code is localized. If it is not found in the - * resource bundle for localized error messages, it is used as the error - * message. - * - * @param where Error location - * @param errCode Error code - * @param args Arguments for parametric replacement - * @param e Parsing exception - */ - private void dispatch(Mark where, String errCode, Object[] args, - Exception e) throws JasperException { - String file = null; - String errMsg = null; - int line = -1; - int column = -1; - boolean hasLocation = false; - - // Localize - if (errCode != null) { - errMsg = Localizer.getMessage(errCode, args); - } else if (e != null) { - // give a hint about what's wrong - errMsg = e.getMessage(); - } - - // Get error location - if (where != null) { - if (jspcMode) { - // Get the full URL of the resource that caused the error - try { - file = where.getURL().toString(); - } catch (MalformedURLException me) { - // Fallback to using context-relative path - file = where.getFile(); - } - } else { - // Get the context-relative resource path, so as to not - // disclose any local filesystem details - file = where.getFile(); - } - line = where.getLineNumber(); - column = where.getColumnNumber(); - hasLocation = true; - } - - // Get nested exception - Exception nestedEx = e; - if ((e instanceof SAXException) - && (((SAXException) e).getException() != null)) { - nestedEx = ((SAXException) e).getException(); - } - - if (hasLocation) { - errHandler.jspError(file, line, column, errMsg, nestedEx); - } else { - errHandler.jspError(errMsg, nestedEx); - } - } - - /* - * Parses the given Java compilation error message, which may contain one - * or more compilation errors, into an array of JavacErrorDetail instances. - * - * Each JavacErrorDetail instance contains the information about a single - * compilation error. - * - * @param errMsg Compilation error message that was generated by the - * javac compiler - * @param fname Name of Java source file whose compilation failed - * @param page Node representation of JSP page from which the Java source - * file was generated - * - * @return Array of JavacErrorDetail instances corresponding to the - * compilation errors - */ - private static JavacErrorDetail[] parseJavacMessage( - String errMsg, String fname, Node.Nodes page) - throws IOException, JasperException { - - ArrayList errors = new ArrayList(); - StringBuffer errMsgBuf = null; - int lineNum = -1; - JavacErrorDetail javacError = null; - - BufferedReader reader = new BufferedReader(new StringReader(errMsg)); - - /* - * Parse compilation errors. Each compilation error consists of a file - * path and error line number, followed by a number of lines describing - * the error. - */ - String line = null; - while ((line = reader.readLine()) != null) { - - /* - * Error line number is delimited by set of colons. - * Ignore colon following drive letter on Windows (fromIndex = 2). - * XXX Handle deprecation warnings that don't have line info - */ - int beginColon = line.indexOf(':', 2); - int endColon = line.indexOf(':', beginColon + 1); - if ((beginColon >= 0) && (endColon >= 0)) { - if (javacError != null) { - // add previous error to error vector - errors.add(javacError); - } - - String lineNumStr = line.substring(beginColon + 1, endColon); - try { - lineNum = Integer.parseInt(lineNumStr); - } catch (NumberFormatException e) { - lineNum = -1; - } - - errMsgBuf = new StringBuffer(); - - javacError = createJavacError(fname, page, errMsgBuf, lineNum); - } - - // Ignore messages preceding first error - if (errMsgBuf != null) { - errMsgBuf.append(line); - errMsgBuf.append("\n"); - } - } - - // Add last error to error vector - if (javacError != null) { - errors.add(javacError); - } - - reader.close(); - - JavacErrorDetail[] errDetails = null; - if (errors.size() > 0) { - errDetails = new JavacErrorDetail[errors.size()]; - errors.toArray(errDetails); - } - - return errDetails; - } - - - /** - * @param fname - * @param page - * @param errMsgBuf - * @param lineNum - * @return JavacErrorDetail The error details - * @throws JasperException - */ - public static JavacErrorDetail createJavacError(String fname, - Node.Nodes page, StringBuffer errMsgBuf, int lineNum) - throws JasperException { - return createJavacError(fname, page, errMsgBuf, lineNum, null); - } - - - /** - * @param fname - * @param page - * @param errMsgBuf - * @param lineNum - * @param ctxt - * @return JavacErrorDetail The error details - * @throws JasperException - */ - public static JavacErrorDetail createJavacError(String fname, - Node.Nodes page, StringBuffer errMsgBuf, int lineNum, - JspCompilationContext ctxt) throws JasperException { - JavacErrorDetail javacError; - // Attempt to map javac error line number to line in JSP page - ErrorVisitor errVisitor = new ErrorVisitor(lineNum); - page.visit(errVisitor); - Node errNode = errVisitor.getJspSourceNode(); - if ((errNode != null) && (errNode.getStart() != null)) { - // If this is a scriplet node then there is a one to one mapping - // between JSP lines and Java lines - if (errVisitor.getJspSourceNode() instanceof Node.Scriptlet) { - javacError = new JavacErrorDetail( - fname, - lineNum, - errNode.getStart().getFile(), - errNode.getStart().getLineNumber() + lineNum - - errVisitor.getJspSourceNode().getBeginJavaLine(), - errMsgBuf, - ctxt); - } else { - javacError = new JavacErrorDetail( - fname, - lineNum, - errNode.getStart().getFile(), - errNode.getStart().getLineNumber(), - errMsgBuf, - ctxt); - } - } else { - /* - * javac error line number cannot be mapped to JSP page - * line number. For example, this is the case if a - * scriptlet is missing a closing brace, which causes - * havoc with the try-catch-finally block that the code - * generator places around all generated code: As a result - * of this, the javac error line numbers will be outside - * the range of begin and end java line numbers that were - * generated for the scriptlet, and therefore cannot be - * mapped to the start line number of the scriptlet in the - * JSP page. - * Include just the javac error info in the error detail. - */ - javacError = new JavacErrorDetail( - fname, - lineNum, - errMsgBuf); - } - return javacError; - } - - - /* - * Visitor responsible for mapping a line number in the generated servlet - * source code to the corresponding JSP node. - */ - static class ErrorVisitor extends Node.Visitor { - - // Java source line number to be mapped - private int lineNum; - - /* - * JSP node whose Java source code range in the generated servlet - * contains the Java source line number to be mapped - */ - Node found; - - /* - * Constructor. - * - * @param lineNum Source line number in the generated servlet code - */ - public ErrorVisitor(int lineNum) { - this.lineNum = lineNum; - } - - public void doVisit(Node n) throws JasperException { - if ((lineNum >= n.getBeginJavaLine()) - && (lineNum < n.getEndJavaLine())) { - found = n; - } - } - - /* - * Gets the JSP node to which the source line number in the generated - * servlet code was mapped. - * - * @return JSP node to which the source line number in the generated - * servlet code was mapped - */ - public Node getJspSourceNode() { - return found; - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ErrorHandler.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ErrorHandler.java deleted file mode 100644 index a998edaf0..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ErrorHandler.java +++ /dev/null @@ -1,73 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import org.apache.jasper.JasperException; - -/** - * Interface for handling JSP parse and javac compilation errors. - * - * An implementation of this interface may be registered with the - * ErrorDispatcher by setting the XXX initialization parameter in the JSP - * page compiler and execution servlet in Catalina's web.xml file to the - * implementation's fully qualified class name. - * - * @author Jan Luehe - * @author Kin-man Chung - */ -public interface ErrorHandler { - - /** - * Processes the given JSP parse error. - * - * @param fname Name of the JSP file in which the parse error occurred - * @param line Parse error line number - * @param column Parse error column number - * @param msg Parse error message - * @param exception Parse exception - */ - public void jspError(String fname, int line, int column, String msg, - Exception exception) throws JasperException; - - /** - * Processes the given JSP parse error. - * - * @param msg Parse error message - * @param exception Parse exception - */ - public void jspError(String msg, Exception exception) - throws JasperException; - - /** - * Processes the given javac compilation errors. - * - * @param details Array of JavacErrorDetail instances corresponding to the - * compilation errors - */ - public void javacError(JavacErrorDetail[] details) - throws JasperException; - - /** - * Processes the given javac error report and exception. - * - * @param errorReport Compilation error report - * @param exception Compilation exception - */ - public void javacError(String errorReport, Exception exception) - throws JasperException; -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Generator.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Generator.java deleted file mode 100644 index 59c2d27e6..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Generator.java +++ /dev/null @@ -1,4199 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.beans.BeanInfo; -import java.beans.IntrospectionException; -import java.beans.Introspector; -import java.beans.PropertyDescriptor; -import java.lang.reflect.Method; -import java.lang.reflect.Modifier; -import java.util.ArrayList; -import java.util.Arrays; -import java.util.Collections; -import java.util.Enumeration; -import java.util.Hashtable; -import java.util.HashMap; -import java.util.Iterator; -import java.util.List; -import java.util.Vector; - -import javax.el.MethodExpression; -import javax.el.ValueExpression; -import javax.servlet.jsp.tagext.TagAttributeInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagVariableInfo; -import javax.servlet.jsp.tagext.VariableInfo; - -import org.apache.jasper.Constants; -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.compiler.Node.NamedAttribute; -import org.apache.jasper.runtime.JspRuntimeLibrary; -import org.xml.sax.Attributes; - -/** - * Generate Java source from Nodes - * - * @author Anil K. Vijendran - * @author Danno Ferrin - * @author Mandar Raje - * @author Rajiv Mordani - * @author Pierre Delisle - * - * Tomcat 4.1.x and Tomcat 5: - * @author Kin-man Chung - * @author Jan Luehe - * @author Shawn Bayern - * @author Mark Roth - * @author Denis Benoit - * - * Tomcat 6.x - * @author Jacob Hookom - * @author Remy Maucherat - */ - -class Generator { - - private static final Class[] OBJECT_CLASS = { Object.class }; - - private static final String VAR_EXPRESSIONFACTORY = - System.getProperty("org.apache.jasper.compiler.Generator.VAR_EXPRESSIONFACTORY", "_el_expressionfactory"); - private static final String VAR_ANNOTATIONPROCESSOR = - System.getProperty("org.apache.jasper.compiler.Generator.VAR_ANNOTATIONPROCESSOR", "_jsp_annotationprocessor"); - - private ServletWriter out; - - private ArrayList methodsBuffered; - - private FragmentHelperClass fragmentHelperClass; - - private ErrorDispatcher err; - - private BeanRepository beanInfo; - - private JspCompilationContext ctxt; - - private boolean isPoolingEnabled; - - private boolean breakAtLF; - - private String jspIdPrefix; - - private int jspId; - - private PageInfo pageInfo; - - private Vector tagHandlerPoolNames; - - private GenBuffer charArrayBuffer; - - /** - * @param s - * the input string - * @return quoted and escaped string, per Java rule - */ - static String quote(String s) { - - if (s == null) - return "null"; - - return '"' + escape(s) + '"'; - } - - /** - * @param s - * the input string - * @return escaped string, per Java rule - */ - static String escape(String s) { - - if (s == null) - return ""; - - StringBuffer b = new StringBuffer(); - for (int i = 0; i < s.length(); i++) { - char c = s.charAt(i); - if (c == '"') - b.append('\\').append('"'); - else if (c == '\\') - b.append('\\').append('\\'); - else if (c == '\n') - b.append('\\').append('n'); - else if (c == '\r') - b.append('\\').append('r'); - else - b.append(c); - } - return b.toString(); - } - - /** - * Single quote and escape a character - */ - static String quote(char c) { - - StringBuffer b = new StringBuffer(); - b.append('\''); - if (c == '\'') - b.append('\\').append('\''); - else if (c == '\\') - b.append('\\').append('\\'); - else if (c == '\n') - b.append('\\').append('n'); - else if (c == '\r') - b.append('\\').append('r'); - else - b.append(c); - b.append('\''); - return b.toString(); - } - - private String createJspId() throws JasperException { - if (this.jspIdPrefix == null) { - StringBuffer sb = new StringBuffer(32); - String name = ctxt.getServletJavaFileName(); - sb.append("jsp_").append(Math.abs(name.hashCode())).append('_'); - this.jspIdPrefix = sb.toString(); - } - return this.jspIdPrefix + (this.jspId++); - } - - /** - * Generates declarations. This includes "info" of the page directive, and - * scriptlet declarations. - */ - private void generateDeclarations(Node.Nodes page) throws JasperException { - - class DeclarationVisitor extends Node.Visitor { - - private boolean getServletInfoGenerated = false; - - /* - * Generates getServletInfo() method that returns the value of the - * page directive's 'info' attribute, if present. - * - * The Validator has already ensured that if the translation unit - * contains more than one page directive with an 'info' attribute, - * their values match. - */ - public void visit(Node.PageDirective n) throws JasperException { - - if (getServletInfoGenerated) { - return; - } - - String info = n.getAttributeValue("info"); - if (info == null) - return; - - getServletInfoGenerated = true; - out.printil("public String getServletInfo() {"); - out.pushIndent(); - out.printin("return "); - out.print(quote(info)); - out.println(";"); - out.popIndent(); - out.printil("}"); - out.println(); - } - - public void visit(Node.Declaration n) throws JasperException { - n.setBeginJavaLine(out.getJavaLine()); - out.printMultiLn(new String(n.getText())); - out.println(); - n.setEndJavaLine(out.getJavaLine()); - } - - // Custom Tags may contain declarations from tag plugins. - public void visit(Node.CustomTag n) throws JasperException { - if (n.useTagPlugin()) { - if (n.getAtSTag() != null) { - n.getAtSTag().visit(this); - } - visitBody(n); - if (n.getAtETag() != null) { - n.getAtETag().visit(this); - } - } else { - visitBody(n); - } - } - } - - out.println(); - page.visit(new DeclarationVisitor()); - } - - /** - * Compiles list of tag handler pool names. - */ - private void compileTagHandlerPoolList(Node.Nodes page) - throws JasperException { - - class TagHandlerPoolVisitor extends Node.Visitor { - - private Vector names; - - /* - * Constructor - * - * @param v Vector of tag handler pool names to populate - */ - TagHandlerPoolVisitor(Vector v) { - names = v; - } - - /* - * Gets the name of the tag handler pool for the given custom tag - * and adds it to the list of tag handler pool names unless it is - * already contained in it. - */ - public void visit(Node.CustomTag n) throws JasperException { - - if (!n.implementsSimpleTag()) { - String name = createTagHandlerPoolName(n.getPrefix(), n - .getLocalName(), n.getAttributes(), - n.getNamedAttributeNodes(), n.hasEmptyBody()); - n.setTagHandlerPoolName(name); - if (!names.contains(name)) { - names.add(name); - } - } - visitBody(n); - } - - /* - * Creates the name of the tag handler pool whose tag handlers may - * be (re)used to service this action. - * - * @return The name of the tag handler pool - */ - private String createTagHandlerPoolName(String prefix, - String shortName, Attributes attrs, Node.Nodes namedAttrs, - boolean hasEmptyBody) { - String poolName = null; - - poolName = "_jspx_tagPool_" + prefix + "_" + shortName; - if (attrs != null) { - String[] attrNames = - new String[attrs.getLength() + namedAttrs.size()]; - for (int i = 0; i < attrNames.length; i++) { - attrNames[i] = attrs.getQName(i); - } - for (int i = 0; i < namedAttrs.size(); i++) { - attrNames[attrs.getLength() + i] = - ((NamedAttribute) namedAttrs.getNode(i)).getQName(); - } - Arrays.sort(attrNames, Collections.reverseOrder()); - if (attrNames.length > 0) { - poolName = poolName + "&"; - } - for (int i = 0; i < attrNames.length; i++) { - poolName = poolName + "_" + attrNames[i]; - } - } - if (hasEmptyBody) { - poolName = poolName + "_nobody"; - } - return JspUtil.makeJavaIdentifier(poolName); - } - } - - page.visit(new TagHandlerPoolVisitor(tagHandlerPoolNames)); - } - - private void declareTemporaryScriptingVars(Node.Nodes page) - throws JasperException { - - class ScriptingVarVisitor extends Node.Visitor { - - private Vector vars; - - ScriptingVarVisitor() { - vars = new Vector(); - } - - public void visit(Node.CustomTag n) throws JasperException { - - if (n.getCustomNestingLevel() > 0) { - TagVariableInfo[] tagVarInfos = n.getTagVariableInfos(); - VariableInfo[] varInfos = n.getVariableInfos(); - - if (varInfos.length > 0) { - for (int i = 0; i < varInfos.length; i++) { - String varName = varInfos[i].getVarName(); - String tmpVarName = "_jspx_" + varName + "_" - + n.getCustomNestingLevel(); - if (!vars.contains(tmpVarName)) { - vars.add(tmpVarName); - out.printin(varInfos[i].getClassName()); - out.print(" "); - out.print(tmpVarName); - out.print(" = "); - out.print(null); - out.println(";"); - } - } - } else { - for (int i = 0; i < tagVarInfos.length; i++) { - String varName = tagVarInfos[i].getNameGiven(); - if (varName == null) { - varName = n.getTagData().getAttributeString( - tagVarInfos[i].getNameFromAttribute()); - } else if (tagVarInfos[i].getNameFromAttribute() != null) { - // alias - continue; - } - String tmpVarName = "_jspx_" + varName + "_" - + n.getCustomNestingLevel(); - if (!vars.contains(tmpVarName)) { - vars.add(tmpVarName); - out.printin(tagVarInfos[i].getClassName()); - out.print(" "); - out.print(tmpVarName); - out.print(" = "); - out.print(null); - out.println(";"); - } - } - } - } - - visitBody(n); - } - } - - page.visit(new ScriptingVarVisitor()); - } - - /** - * Generates the _jspInit() method for instantiating the tag handler pools. - * For tag file, _jspInit has to be invoked manually, and the ServletConfig - * object explicitly passed. - * - * In JSP 2.1, we also instantiate an ExpressionFactory - */ - private void generateInit() { - - if (ctxt.isTagFile()) { - out.printil("private void _jspInit(ServletConfig config) {"); - } else { - out.printil("public void _jspInit() {"); - } - - out.pushIndent(); - if (isPoolingEnabled) { - for (int i = 0; i < tagHandlerPoolNames.size(); i++) { - out.printin(tagHandlerPoolNames.elementAt(i)); - out.print(" = org.apache.jasper.runtime.TagHandlerPool.getTagHandlerPool("); - if (ctxt.isTagFile()) { - out.print("config"); - } else { - out.print("getServletConfig()"); - } - out.println(");"); - } - } - - out.printin(VAR_EXPRESSIONFACTORY); - out.print(" = _jspxFactory.getJspApplicationContext("); - if (ctxt.isTagFile()) { - out.print("config"); - } else { - out.print("getServletConfig()"); - } - out.println(".getServletContext()).getExpressionFactory();"); - - out.printin(VAR_ANNOTATIONPROCESSOR); - out.print(" = (org.apache.AnnotationProcessor) "); - if (ctxt.isTagFile()) { - out.print("config"); - } else { - out.print("getServletConfig()"); - } - out.println(".getServletContext().getAttribute(org.apache.AnnotationProcessor.class.getName());"); - - out.popIndent(); - out.printil("}"); - out.println(); - } - - /** - * Generates the _jspDestroy() method which is responsible for calling the - * release() method on every tag handler in any of the tag handler pools. - */ - private void generateDestroy() { - - out.printil("public void _jspDestroy() {"); - out.pushIndent(); - - if (isPoolingEnabled) { - for (int i = 0; i < tagHandlerPoolNames.size(); i++) { - out.printin((String) tagHandlerPoolNames.elementAt(i)); - out.println(".release();"); - } - } - - out.popIndent(); - out.printil("}"); - out.println(); - } - - /** - * Generate preamble package name (shared by servlet and tag handler - * preamble generation) - */ - private void genPreamblePackage(String packageName) throws JasperException { - if (!"".equals(packageName) && packageName != null) { - out.printil("package " + packageName + ";"); - out.println(); - } - } - - /** - * Generate preamble imports (shared by servlet and tag handler preamble - * generation) - */ - private void genPreambleImports() throws JasperException { - Iterator iter = pageInfo.getImports().iterator(); - while (iter.hasNext()) { - out.printin("import "); - out.print((String) iter.next()); - out.println(";"); - } - - out.println(); - } - - /** - * Generation of static initializers in preamble. For example, dependant - * list, el function map, prefix map. (shared by servlet and tag handler - * preamble generation) - */ - private void genPreambleStaticInitializers() throws JasperException { - out.printil("private static final JspFactory _jspxFactory = JspFactory.getDefaultFactory();"); - out.println(); - - // Static data for getDependants() - out.printil("private static java.util.List _jspx_dependants;"); - out.println(); - List dependants = pageInfo.getDependants(); - Iterator iter = dependants.iterator(); - if (!dependants.isEmpty()) { - out.printil("static {"); - out.pushIndent(); - out.printin("_jspx_dependants = new java.util.ArrayList("); - out.print("" + dependants.size()); - out.println(");"); - while (iter.hasNext()) { - out.printin("_jspx_dependants.add(\""); - out.print((String) iter.next()); - out.println("\");"); - } - out.popIndent(); - out.printil("}"); - out.println(); - } - } - - /** - * Declare tag handler pools (tags of the same type and with the same - * attribute set share the same tag handler pool) (shared by servlet and tag - * handler preamble generation) - * - * In JSP 2.1, we also scope an instance of ExpressionFactory - */ - private void genPreambleClassVariableDeclarations(String className) - throws JasperException { - if (isPoolingEnabled && !tagHandlerPoolNames.isEmpty()) { - for (int i = 0; i < tagHandlerPoolNames.size(); i++) { - out.printil("private org.apache.jasper.runtime.TagHandlerPool " - + tagHandlerPoolNames.elementAt(i) + ";"); - } - out.println(); - } - out.printin("private javax.el.ExpressionFactory "); - out.print(VAR_EXPRESSIONFACTORY); - out.println(";"); - out.printin("private org.apache.AnnotationProcessor "); - out.print(VAR_ANNOTATIONPROCESSOR); - out.println(";"); - out.println(); - } - - /** - * Declare general-purpose methods (shared by servlet and tag handler - * preamble generation) - */ - private void genPreambleMethods() throws JasperException { - // Method used to get compile time file dependencies - out.printil("public Object getDependants() {"); - out.pushIndent(); - out.printil("return _jspx_dependants;"); - out.popIndent(); - out.printil("}"); - out.println(); - - generateInit(); - generateDestroy(); - } - - /** - * Generates the beginning of the static portion of the servlet. - */ - private void generatePreamble(Node.Nodes page) throws JasperException { - - String servletPackageName = ctxt.getServletPackageName(); - String servletClassName = ctxt.getServletClassName(); - String serviceMethodName = Constants.SERVICE_METHOD_NAME; - - // First the package name: - genPreamblePackage(servletPackageName); - - // Generate imports - genPreambleImports(); - - // Generate class declaration - out.printin("public final class "); - out.print(servletClassName); - out.print(" extends "); - out.println(pageInfo.getExtends()); - out.printin(" implements org.apache.jasper.runtime.JspSourceDependent"); - if (!pageInfo.isThreadSafe()) { - out.println(","); - out.printin(" SingleThreadModel"); - } - out.println(" {"); - out.pushIndent(); - - // Class body begins here - generateDeclarations(page); - - // Static initializations here - genPreambleStaticInitializers(); - - // Class variable declarations - genPreambleClassVariableDeclarations(servletClassName); - - // Constructor - // generateConstructor(className); - - // Methods here - genPreambleMethods(); - - // Now the service method - out.printin("public void "); - out.print(serviceMethodName); - out.println("(HttpServletRequest request, HttpServletResponse response)"); - out.println(" throws java.io.IOException, ServletException {"); - - out.pushIndent(); - out.println(); - - // Local variable declarations - out.printil("PageContext pageContext = null;"); - - if (pageInfo.isSession()) - out.printil("HttpSession session = null;"); - - if (pageInfo.isErrorPage()) { - out.printil("Throwable exception = org.apache.jasper.runtime.JspRuntimeLibrary.getThrowable(request);"); - out.printil("if (exception != null) {"); - out.pushIndent(); - out.printil("response.setStatus(HttpServletResponse.SC_INTERNAL_SERVER_ERROR);"); - out.popIndent(); - out.printil("}"); - } - - out.printil("ServletContext application = null;"); - out.printil("ServletConfig config = null;"); - out.printil("JspWriter out = null;"); - out.printil("Object page = this;"); - - out.printil("JspWriter _jspx_out = null;"); - out.printil("PageContext _jspx_page_context = null;"); - out.println(); - - declareTemporaryScriptingVars(page); - out.println(); - - out.printil("try {"); - out.pushIndent(); - - out.printin("response.setContentType("); - out.print(quote(pageInfo.getContentType())); - out.println(");"); - - if (ctxt.getOptions().isXpoweredBy()) { - out.printil("response.addHeader(\"X-Powered-By\", \"JSP/2.1\");"); - } - - out - .printil("pageContext = _jspxFactory.getPageContext(this, request, response,"); - out.printin("\t\t\t"); - out.print(quote(pageInfo.getErrorPage())); - out.print(", " + pageInfo.isSession()); - out.print(", " + pageInfo.getBuffer()); - out.print(", " + pageInfo.isAutoFlush()); - out.println(");"); - out.printil("_jspx_page_context = pageContext;"); - - out.printil("application = pageContext.getServletContext();"); - out.printil("config = pageContext.getServletConfig();"); - - if (pageInfo.isSession()) - out.printil("session = pageContext.getSession();"); - out.printil("out = pageContext.getOut();"); - out.printil("_jspx_out = out;"); - out.println(); - } - - /** - * Generates an XML Prolog, which includes an XML declaration and an XML - * doctype declaration. - */ - private void generateXmlProlog(Node.Nodes page) { - - /* - * An XML declaration is generated under the following conditions: - - * 'omit-xml-declaration' attribute of action is set to - * "no" or "false" - JSP document without a - */ - String omitXmlDecl = pageInfo.getOmitXmlDecl(); - if ((omitXmlDecl != null && !JspUtil.booleanValue(omitXmlDecl)) - || (omitXmlDecl == null && page.getRoot().isXmlSyntax() - && !pageInfo.hasJspRoot() && !ctxt.isTagFile())) { - String cType = pageInfo.getContentType(); - String charSet = cType.substring(cType.indexOf("charset=") + 8); - out.printil("out.write(\"\\n\");"); - } - - /* - * Output a DOCTYPE declaration if the doctype-root-element appears. If - * doctype-public appears: else - */ - - String doctypeName = pageInfo.getDoctypeName(); - if (doctypeName != null) { - String doctypePublic = pageInfo.getDoctypePublic(); - String doctypeSystem = pageInfo.getDoctypeSystem(); - out.printin("out.write(\"\\n\");"); - } - } - - /* - * Generates the constructor. (shared by servlet and tag handler preamble - * generation) - */ - private void generateConstructor(String className) { - out.printil("public " + className + "() {"); - out.printil("}"); - out.println(); - } - - /** - * A visitor that generates codes for the elements in the page. - */ - class GenerateVisitor extends Node.Visitor { - - /* - * Hashtable containing introspection information on tag handlers: - * : tag prefix : hashtable containing introspection on tag - * handlers: : tag short name : introspection info of tag - * handler for tag - */ - private Hashtable handlerInfos; - - private Hashtable tagVarNumbers; - - private String parent; - - private boolean isSimpleTagParent; // Is parent a SimpleTag? - - private String pushBodyCountVar; - - private String simpleTagHandlerVar; - - private boolean isSimpleTagHandler; - - private boolean isFragment; - - private boolean isTagFile; - - private ServletWriter out; - - private ArrayList methodsBuffered; - - private FragmentHelperClass fragmentHelperClass; - - private int methodNesting; - - private TagInfo tagInfo; - - private ClassLoader loader; - - private int charArrayCount; - - private HashMap textMap; - - /** - * Constructor. - */ - public GenerateVisitor(boolean isTagFile, ServletWriter out, - ArrayList methodsBuffered, - FragmentHelperClass fragmentHelperClass, ClassLoader loader, - TagInfo tagInfo) { - - this.isTagFile = isTagFile; - this.out = out; - this.methodsBuffered = methodsBuffered; - this.fragmentHelperClass = fragmentHelperClass; - this.loader = loader; - this.tagInfo = tagInfo; - methodNesting = 0; - handlerInfos = new Hashtable(); - tagVarNumbers = new Hashtable(); - textMap = new HashMap(); - } - - /** - * Returns an attribute value, optionally URL encoded. If the value is a - * runtime expression, the result is the expression itself, as a string. - * If the result is an EL expression, we insert a call to the - * interpreter. If the result is a Named Attribute we insert the - * generated variable name. Otherwise the result is a string literal, - * quoted and escaped. - * - * @param attr - * An JspAttribute object - * @param encode - * true if to be URL encoded - * @param expectedType - * the expected type for an EL evaluation (ignored for - * attributes that aren't EL expressions) - */ - private String attributeValue(Node.JspAttribute attr, boolean encode, - Class expectedType) { - String v = attr.getValue(); - if (!attr.isNamedAttribute() && (v == null)) - return ""; - - if (attr.isExpression()) { - if (encode) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.URLEncode(String.valueOf(" - + v + "), request.getCharacterEncoding())"; - } - return v; - } else if (attr.isELInterpreterInput()) { - v = attributeValueWithEL(this.isTagFile, v, expectedType, - attr.getEL().getMapName()); - if (encode) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.URLEncode(" - + v + ", request.getCharacterEncoding())"; - } - return v; - } else if (attr.isNamedAttribute()) { - return attr.getNamedAttributeNode().getTemporaryVariableName(); - } else { - if (encode) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.URLEncode(" - + quote(v) + ", request.getCharacterEncoding())"; - } - return quote(v); - } - } - - - /* - * When interpreting the EL attribute value, literals outside the EL - * must not be unescaped but the EL processor will unescape them. - * Therefore, make sure only the EL expressions are processed by the EL - * processor. - */ - private String attributeValueWithEL(boolean isTag, String tx, - Class expectedType, String mapName) { - if (tx==null) return null; - Class type = expectedType; - int size = tx.length(); - StringBuffer output = new StringBuffer(size); - boolean el = false; - int i = 0; - int mark = 0; - char ch; - - while(i < size){ - ch = tx.charAt(i); - - // Start of an EL expression - if (!el && i+1 < size && ch == '$' && tx.charAt(i+1)=='{') { - if (mark < i) { - if (output.length() > 0) { - output.append(" + "); - // Composite expression - must coerce to String - type = String.class; - } - output.append(quote(tx.substring(mark, i))); - } - mark = i; - el = true; - i += 2; - } else if (ch=='\\' && i+1 < size && - (tx.charAt(i+1)=='$' || tx.charAt(i+1)=='}')) { - // Skip an escaped $ or } - i += 2; - } else if (el && ch=='}') { - // End of an EL expression - if (output.length() > 0) { - output.append(" + "); - // Composite expression - must coerce to String - type = String.class; - } - output.append( - JspUtil.interpreterCall(isTag, - tx.substring(mark, i+1), type, - mapName, false)); - mark = i + 1; - el = false; - ++i; - } else { - // Nothing to see here - move to next character - ++i; - } - } - if (!el && mark < i) { - if (output.length() > 0) { - output.append(" + "); - } - output.append(quote(tx.substring(mark, i))); - } - return output.toString(); - } - - - /** - * Prints the attribute value specified in the param action, in the form - * of name=value string. - * - * @param n - * the parent node for the param action nodes. - */ - private void printParams(Node n, String pageParam, boolean literal) - throws JasperException { - - class ParamVisitor extends Node.Visitor { - String separator; - - ParamVisitor(String separator) { - this.separator = separator; - } - - public void visit(Node.ParamAction n) throws JasperException { - - out.print(" + "); - out.print(separator); - out.print(" + "); - out.print("org.apache.jasper.runtime.JspRuntimeLibrary." - + "URLEncode(" + quote(n.getTextAttribute("name")) - + ", request.getCharacterEncoding())"); - out.print("+ \"=\" + "); - out.print(attributeValue(n.getValue(), true, String.class)); - - // The separator is '&' after the second use - separator = "\"&\""; - } - } - - String sep; - if (literal) { - sep = pageParam.indexOf('?') > 0 ? "\"&\"" : "\"?\""; - } else { - sep = "((" + pageParam + ").indexOf('?')>0? '&': '?')"; - } - if (n.getBody() != null) { - n.getBody().visit(new ParamVisitor(sep)); - } - } - - public void visit(Node.Expression n) throws JasperException { - n.setBeginJavaLine(out.getJavaLine()); - out.printin("out.print("); - out.printMultiLn(n.getText()); - out.println(");"); - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.Scriptlet n) throws JasperException { - n.setBeginJavaLine(out.getJavaLine()); - out.printMultiLn(n.getText()); - out.println(); - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.ELExpression n) throws JasperException { - n.setBeginJavaLine(out.getJavaLine()); - if (!pageInfo.isELIgnored() && (n.getEL() != null)) { - out.printil("out.write(" - + JspUtil.interpreterCall(this.isTagFile, n.getType() + "{" - + new String(n.getText()) + "}", String.class, - n.getEL().getMapName(), false) + ");"); - } else { - out.printil("out.write(" - + quote(n.getType() + "{" + new String(n.getText()) + "}") + ");"); - } - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.IncludeAction n) throws JasperException { - - String flush = n.getTextAttribute("flush"); - Node.JspAttribute page = n.getPage(); - - boolean isFlush = false; // default to false; - if ("true".equals(flush)) - isFlush = true; - - n.setBeginJavaLine(out.getJavaLine()); - - String pageParam; - if (page.isNamedAttribute()) { - // If the page for jsp:include was specified via - // jsp:attribute, first generate code to evaluate - // that body. - pageParam = generateNamedAttributeValue(page - .getNamedAttributeNode()); - } else { - pageParam = attributeValue(page, false, String.class); - } - - // If any of the params have their values specified by - // jsp:attribute, prepare those values first. - Node jspBody = findJspBody(n); - if (jspBody != null) { - prepareParams(jspBody); - } else { - prepareParams(n); - } - - out - .printin("org.apache.jasper.runtime.JspRuntimeLibrary.include(request, response, " - + pageParam); - printParams(n, pageParam, page.isLiteral()); - out.println(", out, " + isFlush + ");"); - - n.setEndJavaLine(out.getJavaLine()); - } - - /** - * Scans through all child nodes of the given parent for - * subelements. For each element, if its value is specified via - * a Named Attribute (), generate the code to evaluate - * those bodies first. - *

- * If parent is null, simply returns. - */ - private void prepareParams(Node parent) throws JasperException { - if (parent == null) - return; - - Node.Nodes subelements = parent.getBody(); - if (subelements != null) { - for (int i = 0; i < subelements.size(); i++) { - Node n = subelements.getNode(i); - if (n instanceof Node.ParamAction) { - Node.Nodes paramSubElements = n.getBody(); - for (int j = 0; (paramSubElements != null) - && (j < paramSubElements.size()); j++) { - Node m = paramSubElements.getNode(j); - if (m instanceof Node.NamedAttribute) { - generateNamedAttributeValue((Node.NamedAttribute) m); - } - } - } - } - } - } - - /** - * Finds the subelement of the given parent node. If not - * found, null is returned. - */ - private Node.JspBody findJspBody(Node parent) throws JasperException { - Node.JspBody result = null; - - Node.Nodes subelements = parent.getBody(); - for (int i = 0; (subelements != null) && (i < subelements.size()); i++) { - Node n = subelements.getNode(i); - if (n instanceof Node.JspBody) { - result = (Node.JspBody) n; - break; - } - } - - return result; - } - - public void visit(Node.ForwardAction n) throws JasperException { - Node.JspAttribute page = n.getPage(); - - n.setBeginJavaLine(out.getJavaLine()); - - out.printil("if (true) {"); // So that javac won't complain about - out.pushIndent(); // codes after "return" - - String pageParam; - if (page.isNamedAttribute()) { - // If the page for jsp:forward was specified via - // jsp:attribute, first generate code to evaluate - // that body. - pageParam = generateNamedAttributeValue(page - .getNamedAttributeNode()); - } else { - pageParam = attributeValue(page, false, String.class); - } - - // If any of the params have their values specified by - // jsp:attribute, prepare those values first. - Node jspBody = findJspBody(n); - if (jspBody != null) { - prepareParams(jspBody); - } else { - prepareParams(n); - } - - out.printin("_jspx_page_context.forward("); - out.print(pageParam); - printParams(n, pageParam, page.isLiteral()); - out.println(");"); - if (isTagFile || isFragment) { - out.printil("throw new SkipPageException();"); - } else { - out.printil((methodNesting > 0) ? "return true;" : "return;"); - } - out.popIndent(); - out.printil("}"); - - n.setEndJavaLine(out.getJavaLine()); - // XXX Not sure if we can eliminate dead codes after this. - } - - public void visit(Node.GetProperty n) throws JasperException { - String name = n.getTextAttribute("name"); - String property = n.getTextAttribute("property"); - - n.setBeginJavaLine(out.getJavaLine()); - - if (beanInfo.checkVariable(name)) { - // Bean is defined using useBean, introspect at compile time - Class bean = beanInfo.getBeanType(name); - String beanName = JspUtil.getCanonicalName(bean); - java.lang.reflect.Method meth = JspRuntimeLibrary - .getReadMethod(bean, property); - String methodName = meth.getName(); - out - .printil("out.write(org.apache.jasper.runtime.JspRuntimeLibrary.toString(" - + "(((" - + beanName - + ")_jspx_page_context.findAttribute(" - + "\"" - + name + "\"))." + methodName + "())));"); - } else { - // The object could be a custom action with an associated - // VariableInfo entry for this name. - // Get the class name and then introspect at runtime. - out - .printil("out.write(org.apache.jasper.runtime.JspRuntimeLibrary.toString" - + "(org.apache.jasper.runtime.JspRuntimeLibrary.handleGetProperty" - + "(_jspx_page_context.getAttribute(\"" - + name - + "\", PageContext.PAGE_SCOPE), \"" - + property - + "\")));"); - } - - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.SetProperty n) throws JasperException { - String name = n.getTextAttribute("name"); - String property = n.getTextAttribute("property"); - String param = n.getTextAttribute("param"); - Node.JspAttribute value = n.getValue(); - - n.setBeginJavaLine(out.getJavaLine()); - - if ("*".equals(property)) { - out - .printil("org.apache.jasper.runtime.JspRuntimeLibrary.introspect(" - + "_jspx_page_context.findAttribute(" - + "\"" - + name + "\"), request);"); - } else if (value == null) { - if (param == null) - param = property; // default to same as property - out - .printil("org.apache.jasper.runtime.JspRuntimeLibrary.introspecthelper(" - + "_jspx_page_context.findAttribute(\"" - + name - + "\"), \"" - + property - + "\", request.getParameter(\"" - + param - + "\"), " - + "request, \"" - + param - + "\", false);"); - } else if (value.isExpression()) { - out - .printil("org.apache.jasper.runtime.JspRuntimeLibrary.handleSetProperty(" - + "_jspx_page_context.findAttribute(\"" - + name - + "\"), \"" + property + "\","); - out.print(attributeValue(value, false, null)); - out.println(");"); - } else if (value.isELInterpreterInput()) { - // We've got to resolve the very call to the interpreter - // at runtime since we don't know what type to expect - // in the general case; we thus can't hard-wire the call - // into the generated code. (XXX We could, however, - // optimize the case where the bean is exposed with - // , much as the code here does for - // getProperty.) - - // The following holds true for the arguments passed to - // JspRuntimeLibrary.handleSetPropertyExpression(): - // - 'pageContext' is a VariableResolver. - // - 'this' (either the generated Servlet or the generated tag - // handler for Tag files) is a FunctionMapper. - out - .printil("org.apache.jasper.runtime.JspRuntimeLibrary.handleSetPropertyExpression(" - + "_jspx_page_context.findAttribute(\"" - + name - + "\"), \"" - + property - + "\", " - + quote(value.getValue()) - + ", " - + "_jspx_page_context, " - + value.getEL().getMapName() + ");"); - } else if (value.isNamedAttribute()) { - // If the value for setProperty was specified via - // jsp:attribute, first generate code to evaluate - // that body. - String valueVarName = generateNamedAttributeValue(value - .getNamedAttributeNode()); - out - .printil("org.apache.jasper.runtime.JspRuntimeLibrary.introspecthelper(" - + "_jspx_page_context.findAttribute(\"" - + name - + "\"), \"" - + property - + "\", " - + valueVarName - + ", null, null, false);"); - } else { - out - .printin("org.apache.jasper.runtime.JspRuntimeLibrary.introspecthelper(" - + "_jspx_page_context.findAttribute(\"" - + name - + "\"), \"" + property + "\", "); - out.print(attributeValue(value, false, null)); - out.println(", null, null, false);"); - } - - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.UseBean n) throws JasperException { - - String name = n.getTextAttribute("id"); - String scope = n.getTextAttribute("scope"); - String klass = n.getTextAttribute("class"); - String type = n.getTextAttribute("type"); - Node.JspAttribute beanName = n.getBeanName(); - - // If "class" is specified, try an instantiation at compile time - boolean generateNew = false; - String canonicalName = null; // Canonical name for klass - if (klass != null) { - try { - Class bean = ctxt.getClassLoader().loadClass(klass); - if (klass.indexOf('$') >= 0) { - // Obtain the canonical type name - canonicalName = JspUtil.getCanonicalName(bean); - } else { - canonicalName = klass; - } - int modifiers = bean.getModifiers(); - if (!Modifier.isPublic(modifiers) - || Modifier.isInterface(modifiers) - || Modifier.isAbstract(modifiers)) { - throw new Exception("Invalid bean class modifier"); - } - // Check that there is a 0 arg constructor - bean.getConstructor(new Class[] {}); - // At compile time, we have determined that the bean class - // exists, with a public zero constructor, new() can be - // used for bean instantiation. - generateNew = true; - } catch (Exception e) { - // Cannot instantiate the specified class, either a - // compilation error or a runtime error will be raised, - // depending on a compiler flag. - if (ctxt.getOptions() - .getErrorOnUseBeanInvalidClassAttribute()) { - err.jspError(n, "jsp.error.invalid.bean", klass); - } - if (canonicalName == null) { - // Doing our best here to get a canonical name - // from the binary name, should work 99.99% of time. - canonicalName = klass.replace('$', '.'); - } - } - if (type == null) { - // if type is unspecified, use "class" as type of bean - type = canonicalName; - } - } - - String scopename = "PageContext.PAGE_SCOPE"; // Default to page - String lock = "_jspx_page_context"; - - if ("request".equals(scope)) { - scopename = "PageContext.REQUEST_SCOPE"; - lock = "request"; - } else if ("session".equals(scope)) { - scopename = "PageContext.SESSION_SCOPE"; - lock = "session"; - } else if ("application".equals(scope)) { - scopename = "PageContext.APPLICATION_SCOPE"; - lock = "application"; - } - - n.setBeginJavaLine(out.getJavaLine()); - - // Declare bean - out.printin(type); - out.print(' '); - out.print(name); - out.println(" = null;"); - - // Lock while getting or creating bean - out.printin("synchronized ("); - out.print(lock); - out.println(") {"); - out.pushIndent(); - - // Locate bean from context - out.printin(name); - out.print(" = ("); - out.print(type); - out.print(") _jspx_page_context.getAttribute("); - out.print(quote(name)); - out.print(", "); - out.print(scopename); - out.println(");"); - - // Create bean - /* - * Check if bean is alredy there - */ - out.printin("if ("); - out.print(name); - out.println(" == null){"); - out.pushIndent(); - if (klass == null && beanName == null) { - /* - * If both class name and beanName is not specified, the bean - * must be found locally, otherwise it's an error - */ - out - .printin("throw new java.lang.InstantiationException(\"bean "); - out.print(name); - out.println(" not found within scope\");"); - } else { - /* - * Instantiate the bean if it is not in the specified scope. - */ - if (!generateNew) { - String binaryName; - if (beanName != null) { - if (beanName.isNamedAttribute()) { - // If the value for beanName was specified via - // jsp:attribute, first generate code to evaluate - // that body. - binaryName = generateNamedAttributeValue(beanName - .getNamedAttributeNode()); - } else { - binaryName = attributeValue(beanName, false, - String.class); - } - } else { - // Implies klass is not null - binaryName = quote(klass); - } - out.printil("try {"); - out.pushIndent(); - out.printin(name); - out.print(" = ("); - out.print(type); - out.print(") java.beans.Beans.instantiate("); - out.print("this.getClass().getClassLoader(), "); - out.print(binaryName); - out.println(");"); - out.popIndent(); - /* - * Note: Beans.instantiate throws ClassNotFoundException if - * the bean class is abstract. - */ - out.printil("} catch (ClassNotFoundException exc) {"); - out.pushIndent(); - out - .printil("throw new InstantiationException(exc.getMessage());"); - out.popIndent(); - out.printil("} catch (Exception exc) {"); - out.pushIndent(); - out.printin("throw new ServletException("); - out.print("\"Cannot create bean of class \" + "); - out.print(binaryName); - out.println(", exc);"); - out.popIndent(); - out.printil("}"); // close of try - } else { - // Implies klass is not null - // Generate codes to instantiate the bean class - out.printin(name); - out.print(" = new "); - out.print(canonicalName); - out.println("();"); - } - /* - * Set attribute for bean in the specified scope - */ - out.printin("_jspx_page_context.setAttribute("); - out.print(quote(name)); - out.print(", "); - out.print(name); - out.print(", "); - out.print(scopename); - out.println(");"); - - // Only visit the body when bean is instantiated - visitBody(n); - } - out.popIndent(); - out.printil("}"); - - // End of lock block - out.popIndent(); - out.printil("}"); - - n.setEndJavaLine(out.getJavaLine()); - } - - /** - * @return a string for the form 'attr = "value"' - */ - private String makeAttr(String attr, String value) { - if (value == null) - return ""; - - return " " + attr + "=\"" + value + '\"'; - } - - public void visit(Node.PlugIn n) throws JasperException { - - /** - * A visitor to handle in a plugin - */ - class ParamVisitor extends Node.Visitor { - - private boolean ie; - - ParamVisitor(boolean ie) { - this.ie = ie; - } - - public void visit(Node.ParamAction n) throws JasperException { - - String name = n.getTextAttribute("name"); - if (name.equalsIgnoreCase("object")) - name = "java_object"; - else if (name.equalsIgnoreCase("type")) - name = "java_type"; - - n.setBeginJavaLine(out.getJavaLine()); - // XXX - Fixed a bug here - value used to be output - // inline, which is only okay if value is not an EL - // expression. Also, key/value pairs for the - // embed tag were not being generated correctly. - // Double check that this is now the correct behavior. - if (ie) { - // We want something of the form - // out.println( "" ); - out.printil("out.write( \"\" );"); - out.printil("out.write(\"\\n\");"); - } else { - // We want something of the form - // out.print( " blah=\"" + ... + "\"" ); - out.printil("out.write( \" " - + escape(name) - + "=\\\"\" + " - + attributeValue(n.getValue(), false, - String.class) + " + \"\\\"\" );"); - } - - n.setEndJavaLine(out.getJavaLine()); - } - } - - String type = n.getTextAttribute("type"); - String code = n.getTextAttribute("code"); - String name = n.getTextAttribute("name"); - Node.JspAttribute height = n.getHeight(); - Node.JspAttribute width = n.getWidth(); - String hspace = n.getTextAttribute("hspace"); - String vspace = n.getTextAttribute("vspace"); - String align = n.getTextAttribute("align"); - String iepluginurl = n.getTextAttribute("iepluginurl"); - String nspluginurl = n.getTextAttribute("nspluginurl"); - String codebase = n.getTextAttribute("codebase"); - String archive = n.getTextAttribute("archive"); - String jreversion = n.getTextAttribute("jreversion"); - - String widthStr = null; - if (width != null) { - if (width.isNamedAttribute()) { - widthStr = generateNamedAttributeValue(width - .getNamedAttributeNode()); - } else { - widthStr = attributeValue(width, false, String.class); - } - } - - String heightStr = null; - if (height != null) { - if (height.isNamedAttribute()) { - heightStr = generateNamedAttributeValue(height - .getNamedAttributeNode()); - } else { - heightStr = attributeValue(height, false, String.class); - } - } - - if (iepluginurl == null) - iepluginurl = Constants.IE_PLUGIN_URL; - if (nspluginurl == null) - nspluginurl = Constants.NS_PLUGIN_URL; - - n.setBeginJavaLine(out.getJavaLine()); - - // If any of the params have their values specified by - // jsp:attribute, prepare those values first. - // Look for a params node and prepare its param subelements: - Node.JspBody jspBody = findJspBody(n); - if (jspBody != null) { - Node.Nodes subelements = jspBody.getBody(); - if (subelements != null) { - for (int i = 0; i < subelements.size(); i++) { - Node m = subelements.getNode(i); - if (m instanceof Node.ParamsAction) { - prepareParams(m); - break; - } - } - } - } - - // XXX - Fixed a bug here - width and height can be set - // dynamically. Double-check if this generation is correct. - - // IE style plugin - // - // First compose the runtime output string - String s0 = "'; - - // Then print the output string to the java file - out.printil("out.write(" + quote(s0) + s1 + s2 + " + " + quote(s3) - + ");"); - out.printil("out.write(\"\\n\");"); - - // for java_code - s0 = "'; - out.printil("out.write(" + quote(s0) + ");"); - out.printil("out.write(\"\\n\");"); - - // for java_codebase - if (codebase != null) { - s0 = "'; - out.printil("out.write(" + quote(s0) + ");"); - out.printil("out.write(\"\\n\");"); - } - - // for java_archive - if (archive != null) { - s0 = "'; - out.printil("out.write(" + quote(s0) + ");"); - out.printil("out.write(\"\\n\");"); - } - - // for type - s0 = " for each in the plugin body - */ - if (n.getBody() != null) - n.getBody().visit(new ParamVisitor(true)); - - /* - * Netscape style plugin part - */ - out.printil("out.write(" + quote("") + ");"); - out.printil("out.write(\"\\n\");"); - s0 = " in plugin body - */ - if (n.getBody() != null) - n.getBody().visit(new ParamVisitor(false)); - - out.printil("out.write(" + quote("/>") + ");"); - out.printil("out.write(\"\\n\");"); - - out.printil("out.write(" + quote("") + ");"); - out.printil("out.write(\"\\n\");"); - - /* - * Fallback - */ - if (n.getBody() != null) { - visitBody(n); - out.printil("out.write(\"\\n\");"); - } - - out.printil("out.write(" + quote("") + ");"); - out.printil("out.write(\"\\n\");"); - - out.printil("out.write(" + quote("") + ");"); - out.printil("out.write(\"\\n\");"); - - out.printil("out.write(" + quote("") + ");"); - out.printil("out.write(\"\\n\");"); - - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.NamedAttribute n) throws JasperException { - // Don't visit body of this tag - we already did earlier. - } - - public void visit(Node.CustomTag n) throws JasperException { - - // Use plugin to generate more efficient code if there is one. - if (n.useTagPlugin()) { - generateTagPlugin(n); - return; - } - - TagHandlerInfo handlerInfo = getTagHandlerInfo(n); - - // Create variable names - String baseVar = createTagVarName(n.getQName(), n.getPrefix(), n - .getLocalName()); - String tagEvalVar = "_jspx_eval_" + baseVar; - String tagHandlerVar = "_jspx_th_" + baseVar; - String tagPushBodyCountVar = "_jspx_push_body_count_" + baseVar; - - // If the tag contains no scripting element, generate its codes - // to a method. - ServletWriter outSave = null; - Node.ChildInfo ci = n.getChildInfo(); - if (ci.isScriptless() && !ci.hasScriptingVars()) { - // The tag handler and its body code can reside in a separate - // method if it is scriptless and does not have any scripting - // variable defined. - - String tagMethod = "_jspx_meth_" + baseVar; - - // Generate a call to this method - out.printin("if ("); - out.print(tagMethod); - out.print("("); - if (parent != null) { - out.print(parent); - out.print(", "); - } - out.print("_jspx_page_context"); - if (pushBodyCountVar != null) { - out.print(", "); - out.print(pushBodyCountVar); - } - out.println("))"); - out.pushIndent(); - out.printil((methodNesting > 0) ? "return true;" : "return;"); - out.popIndent(); - - // Set up new buffer for the method - outSave = out; - /* - * For fragments, their bodies will be generated in fragment - * helper classes, and the Java line adjustments will be done - * there, hence they are set to null here to avoid double - * adjustments. - */ - GenBuffer genBuffer = new GenBuffer(n, - n.implementsSimpleTag() ? null : n.getBody()); - methodsBuffered.add(genBuffer); - out = genBuffer.getOut(); - - methodNesting++; - // Generate code for method declaration - out.println(); - out.pushIndent(); - out.printin("private boolean "); - out.print(tagMethod); - out.print("("); - if (parent != null) { - out.print("javax.servlet.jsp.tagext.JspTag "); - out.print(parent); - out.print(", "); - } - out.print("PageContext _jspx_page_context"); - if (pushBodyCountVar != null) { - out.print(", int[] "); - out.print(pushBodyCountVar); - } - out.println(")"); - out.printil(" throws Throwable {"); - out.pushIndent(); - - // Initilaize local variables used in this method. - if (!isTagFile) { - out - .printil("PageContext pageContext = _jspx_page_context;"); - } - out.printil("JspWriter out = _jspx_page_context.getOut();"); - generateLocalVariables(out, n); - } - - if (n.implementsSimpleTag()) { - generateCustomDoTag(n, handlerInfo, tagHandlerVar); - } else { - /* - * Classic tag handler: Generate code for start element, body, - * and end element - */ - generateCustomStart(n, handlerInfo, tagHandlerVar, tagEvalVar, - tagPushBodyCountVar); - - // visit body - String tmpParent = parent; - parent = tagHandlerVar; - boolean isSimpleTagParentSave = isSimpleTagParent; - isSimpleTagParent = false; - String tmpPushBodyCountVar = null; - if (n.implementsTryCatchFinally()) { - tmpPushBodyCountVar = pushBodyCountVar; - pushBodyCountVar = tagPushBodyCountVar; - } - boolean tmpIsSimpleTagHandler = isSimpleTagHandler; - isSimpleTagHandler = false; - - visitBody(n); - - parent = tmpParent; - isSimpleTagParent = isSimpleTagParentSave; - if (n.implementsTryCatchFinally()) { - pushBodyCountVar = tmpPushBodyCountVar; - } - isSimpleTagHandler = tmpIsSimpleTagHandler; - - generateCustomEnd(n, tagHandlerVar, tagEvalVar, - tagPushBodyCountVar); - } - - if (ci.isScriptless() && !ci.hasScriptingVars()) { - // Generate end of method - if (methodNesting > 0) { - out.printil("return false;"); - } - out.popIndent(); - out.printil("}"); - out.popIndent(); - - methodNesting--; - - // restore previous writer - out = outSave; - } - } - - private static final String SINGLE_QUOTE = "'"; - - private static final String DOUBLE_QUOTE = "\\\""; - - public void visit(Node.UninterpretedTag n) throws JasperException { - - n.setBeginJavaLine(out.getJavaLine()); - - /* - * Write begin tag - */ - out.printin("out.write(\"<"); - out.print(n.getQName()); - - Attributes attrs = n.getNonTaglibXmlnsAttributes(); - int attrsLen = (attrs == null) ? 0 : attrs.getLength(); - for (int i = 0; i < attrsLen; i++) { - out.print(" "); - out.print(attrs.getQName(i)); - out.print("="); - out.print(DOUBLE_QUOTE); - out.print(attrs.getValue(i).replace("\"", """)); - out.print(DOUBLE_QUOTE); - } - - attrs = n.getAttributes(); - attrsLen = (attrs == null) ? 0 : attrs.getLength(); - Node.JspAttribute[] jspAttrs = n.getJspAttributes(); - for (int i = 0; i < attrsLen; i++) { - out.print(" "); - out.print(attrs.getQName(i)); - out.print("="); - if (jspAttrs[i].isELInterpreterInput()) { - out.print("\\\"\" + "); - out.print(attributeValue(jspAttrs[i], false, String.class)); - out.print(" + \"\\\""); - } else { - out.print(DOUBLE_QUOTE); - out.print(attrs.getValue(i).replace("\"", """)); - out.print(DOUBLE_QUOTE); - } - } - - if (n.getBody() != null) { - out.println(">\");"); - - // Visit tag body - visitBody(n); - - /* - * Write end tag - */ - out.printin("out.write(\"\");"); - } else { - out.println("/>\");"); - } - - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.JspElement n) throws JasperException { - - n.setBeginJavaLine(out.getJavaLine()); - - // Compute attribute value string for XML-style and named - // attributes - Hashtable map = new Hashtable(); - Node.JspAttribute[] attrs = n.getJspAttributes(); - for (int i = 0; attrs != null && i < attrs.length; i++) { - String attrStr = null; - if (attrs[i].isNamedAttribute()) { - attrStr = generateNamedAttributeValue(attrs[i] - .getNamedAttributeNode()); - } else { - attrStr = attributeValue(attrs[i], false, Object.class); - } - String s = " + \" " + attrs[i].getName() + "=\\\"\" + " - + attrStr + " + \"\\\"\""; - map.put(attrs[i].getName(), s); - } - - // Write begin tag, using XML-style 'name' attribute as the - // element name - String elemName = attributeValue(n.getNameAttribute(), false, - String.class); - out.printin("out.write(\"<\""); - out.print(" + " + elemName); - - // Write remaining attributes - Enumeration enumeration = map.keys(); - while (enumeration.hasMoreElements()) { - String attrName = (String) enumeration.nextElement(); - out.print((String) map.get(attrName)); - } - - // Does the have nested tags other than - // - boolean hasBody = false; - Node.Nodes subelements = n.getBody(); - if (subelements != null) { - for (int i = 0; i < subelements.size(); i++) { - Node subelem = subelements.getNode(i); - if (!(subelem instanceof Node.NamedAttribute)) { - hasBody = true; - break; - } - } - } - if (hasBody) { - out.println(" + \">\");"); - - // Smap should not include the body - n.setEndJavaLine(out.getJavaLine()); - - // Visit tag body - visitBody(n); - - // Write end tag - out.printin("out.write(\"\");"); - } else { - out.println(" + \"/>\");"); - n.setEndJavaLine(out.getJavaLine()); - } - } - - public void visit(Node.TemplateText n) throws JasperException { - - String text = n.getText(); - - int textSize = text.length(); - if (textSize == 0) { - return; - } - - if (textSize <= 3) { - // Special case small text strings - n.setBeginJavaLine(out.getJavaLine()); - int lineInc = 0; - for (int i = 0; i < textSize; i++) { - char ch = text.charAt(i); - out.printil("out.write(" + quote(ch) + ");"); - if (i > 0) { - n.addSmap(lineInc); - } - if (ch == '\n') { - lineInc++; - } - } - n.setEndJavaLine(out.getJavaLine()); - return; - } - - if (ctxt.getOptions().genStringAsCharArray()) { - // Generate Strings as char arrays, for performance - ServletWriter caOut; - if (charArrayBuffer == null) { - charArrayBuffer = new GenBuffer(); - caOut = charArrayBuffer.getOut(); - caOut.pushIndent(); - textMap = new HashMap(); - } else { - caOut = charArrayBuffer.getOut(); - } - String charArrayName = (String) textMap.get(text); - if (charArrayName == null) { - charArrayName = "_jspx_char_array_" + charArrayCount++; - textMap.put(text, charArrayName); - caOut.printin("static char[] "); - caOut.print(charArrayName); - caOut.print(" = "); - caOut.print(quote(text)); - caOut.println(".toCharArray();"); - } - - n.setBeginJavaLine(out.getJavaLine()); - out.printil("out.write(" + charArrayName + ");"); - n.setEndJavaLine(out.getJavaLine()); - return; - } - - n.setBeginJavaLine(out.getJavaLine()); - - out.printin(); - StringBuffer sb = new StringBuffer("out.write(\""); - int initLength = sb.length(); - int count = JspUtil.CHUNKSIZE; - int srcLine = 0; // relative to starting srouce line - for (int i = 0; i < text.length(); i++) { - char ch = text.charAt(i); - --count; - switch (ch) { - case '"': - sb.append('\\').append('\"'); - break; - case '\\': - sb.append('\\').append('\\'); - break; - case '\r': - sb.append('\\').append('r'); - break; - case '\n': - sb.append('\\').append('n'); - srcLine++; - - if (breakAtLF || count < 0) { - // Generate an out.write() when see a '\n' in template - sb.append("\");"); - out.println(sb.toString()); - if (i < text.length() - 1) { - out.printin(); - } - sb.setLength(initLength); - count = JspUtil.CHUNKSIZE; - } - // add a Smap for this line - n.addSmap(srcLine); - break; - case '\t': // Not sure we need this - sb.append('\\').append('t'); - break; - default: - sb.append(ch); - } - } - - if (sb.length() > initLength) { - sb.append("\");"); - out.println(sb.toString()); - } - - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.JspBody n) throws JasperException { - if (n.getBody() != null) { - if (isSimpleTagHandler) { - out.printin(simpleTagHandlerVar); - out.print(".setJspBody("); - generateJspFragment(n, simpleTagHandlerVar); - out.println(");"); - } else { - visitBody(n); - } - } - } - - public void visit(Node.InvokeAction n) throws JasperException { - - n.setBeginJavaLine(out.getJavaLine()); - - // Copy virtual page scope of tag file to page scope of invoking - // page - out.printil("((org.apache.jasper.runtime.JspContextWrapper) this.jspContext).syncBeforeInvoke();"); - String varReaderAttr = n.getTextAttribute("varReader"); - String varAttr = n.getTextAttribute("var"); - if (varReaderAttr != null || varAttr != null) { - out.printil("_jspx_sout = new java.io.StringWriter();"); - } else { - out.printil("_jspx_sout = null;"); - } - - // Invoke fragment, unless fragment is null - out.printin("if ("); - out.print(toGetterMethod(n.getTextAttribute("fragment"))); - out.println(" != null) {"); - out.pushIndent(); - out.printin(toGetterMethod(n.getTextAttribute("fragment"))); - out.println(".invoke(_jspx_sout);"); - out.popIndent(); - out.printil("}"); - - // Store varReader in appropriate scope - if (varReaderAttr != null || varAttr != null) { - String scopeName = n.getTextAttribute("scope"); - out.printin("_jspx_page_context.setAttribute("); - if (varReaderAttr != null) { - out.print(quote(varReaderAttr)); - out.print(", new java.io.StringReader(_jspx_sout.toString())"); - } else { - out.print(quote(varAttr)); - out.print(", _jspx_sout.toString()"); - } - if (scopeName != null) { - out.print(", "); - out.print(getScopeConstant(scopeName)); - } - out.println(");"); - } - - // Restore EL context - out.printil("jspContext.getELContext().putContext(JspContext.class,getJspContext());"); - - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.DoBodyAction n) throws JasperException { - - n.setBeginJavaLine(out.getJavaLine()); - - // Copy virtual page scope of tag file to page scope of invoking - // page - out.printil("((org.apache.jasper.runtime.JspContextWrapper) this.jspContext).syncBeforeInvoke();"); - - // Invoke body - String varReaderAttr = n.getTextAttribute("varReader"); - String varAttr = n.getTextAttribute("var"); - if (varReaderAttr != null || varAttr != null) { - out.printil("_jspx_sout = new java.io.StringWriter();"); - } else { - out.printil("_jspx_sout = null;"); - } - out.printil("if (getJspBody() != null)"); - out.pushIndent(); - out.printil("getJspBody().invoke(_jspx_sout);"); - out.popIndent(); - - // Store varReader in appropriate scope - if (varReaderAttr != null || varAttr != null) { - String scopeName = n.getTextAttribute("scope"); - out.printin("_jspx_page_context.setAttribute("); - if (varReaderAttr != null) { - out.print(quote(varReaderAttr)); - out - .print(", new java.io.StringReader(_jspx_sout.toString())"); - } else { - out.print(quote(varAttr)); - out.print(", _jspx_sout.toString()"); - } - if (scopeName != null) { - out.print(", "); - out.print(getScopeConstant(scopeName)); - } - out.println(");"); - } - - // Restore EL context - out.printil("jspContext.getELContext().putContext(JspContext.class,getJspContext());"); - - n.setEndJavaLine(out.getJavaLine()); - } - - public void visit(Node.AttributeGenerator n) throws JasperException { - Node.CustomTag tag = n.getTag(); - Node.JspAttribute[] attrs = tag.getJspAttributes(); - for (int i = 0; attrs != null && i < attrs.length; i++) { - if (attrs[i].getName().equals(n.getName())) { - out.print(evaluateAttribute(getTagHandlerInfo(tag), - attrs[i], tag, null)); - break; - } - } - } - - private TagHandlerInfo getTagHandlerInfo(Node.CustomTag n) - throws JasperException { - Hashtable handlerInfosByShortName = (Hashtable) handlerInfos.get(n - .getPrefix()); - if (handlerInfosByShortName == null) { - handlerInfosByShortName = new Hashtable(); - handlerInfos.put(n.getPrefix(), handlerInfosByShortName); - } - TagHandlerInfo handlerInfo = (TagHandlerInfo) handlerInfosByShortName - .get(n.getLocalName()); - if (handlerInfo == null) { - handlerInfo = new TagHandlerInfo(n, n.getTagHandlerClass(), err); - handlerInfosByShortName.put(n.getLocalName(), handlerInfo); - } - return handlerInfo; - } - - private void generateTagPlugin(Node.CustomTag n) throws JasperException { - if (n.getAtSTag() != null) { - n.getAtSTag().visit(this); - } - visitBody(n); - if (n.getAtETag() != null) { - n.getAtETag().visit(this); - } - } - - private void generateCustomStart(Node.CustomTag n, - TagHandlerInfo handlerInfo, String tagHandlerVar, - String tagEvalVar, String tagPushBodyCountVar) - throws JasperException { - - Class tagHandlerClass = handlerInfo.getTagHandlerClass(); - - out.printin("// "); - out.println(n.getQName()); - n.setBeginJavaLine(out.getJavaLine()); - - // Declare AT_BEGIN scripting variables - declareScriptingVars(n, VariableInfo.AT_BEGIN); - saveScriptingVars(n, VariableInfo.AT_BEGIN); - - String tagHandlerClassName = JspUtil - .getCanonicalName(tagHandlerClass); - out.printin(tagHandlerClassName); - out.print(" "); - out.print(tagHandlerVar); - out.print(" = "); - if (isPoolingEnabled && !(n.implementsJspIdConsumer())) { - out.print("("); - out.print(tagHandlerClassName); - out.print(") "); - out.print(n.getTagHandlerPoolName()); - out.print(".get("); - out.print(tagHandlerClassName); - out.println(".class);"); - } else { - out.print("new "); - out.print(tagHandlerClassName); - out.println("();"); - out.printin("org.apache.jasper.runtime.AnnotationHelper.postConstruct("); - out.print(VAR_ANNOTATIONPROCESSOR); - out.print(", "); - out.print(tagHandlerVar); - out.println(");"); - } - - // includes setting the context - generateSetters(n, tagHandlerVar, handlerInfo, false); - - // JspIdConsumer (after context has been set) - if (n.implementsJspIdConsumer()) { - out.printin(tagHandlerVar); - out.print(".setJspId(\""); - out.print(createJspId()); - out.println("\");"); - } - - if (n.implementsTryCatchFinally()) { - out.printin("int[] "); - out.print(tagPushBodyCountVar); - out.println(" = new int[] { 0 };"); - out.printil("try {"); - out.pushIndent(); - } - out.printin("int "); - out.print(tagEvalVar); - out.print(" = "); - out.print(tagHandlerVar); - out.println(".doStartTag();"); - - if (!n.implementsBodyTag()) { - // Synchronize AT_BEGIN scripting variables - syncScriptingVars(n, VariableInfo.AT_BEGIN); - } - - if (!n.hasEmptyBody()) { - out.printin("if ("); - out.print(tagEvalVar); - out.println(" != javax.servlet.jsp.tagext.Tag.SKIP_BODY) {"); - out.pushIndent(); - - // Declare NESTED scripting variables - declareScriptingVars(n, VariableInfo.NESTED); - saveScriptingVars(n, VariableInfo.NESTED); - - if (n.implementsBodyTag()) { - out.printin("if ("); - out.print(tagEvalVar); - out - .println(" != javax.servlet.jsp.tagext.Tag.EVAL_BODY_INCLUDE) {"); - // Assume EVAL_BODY_BUFFERED - out.pushIndent(); - out.printil("out = _jspx_page_context.pushBody();"); - if (n.implementsTryCatchFinally()) { - out.printin(tagPushBodyCountVar); - out.println("[0]++;"); - } else if (pushBodyCountVar != null) { - out.printin(pushBodyCountVar); - out.println("[0]++;"); - } - out.printin(tagHandlerVar); - out - .println(".setBodyContent((javax.servlet.jsp.tagext.BodyContent) out);"); - out.printin(tagHandlerVar); - out.println(".doInitBody();"); - - out.popIndent(); - out.printil("}"); - - // Synchronize AT_BEGIN and NESTED scripting variables - syncScriptingVars(n, VariableInfo.AT_BEGIN); - syncScriptingVars(n, VariableInfo.NESTED); - - } else { - // Synchronize NESTED scripting variables - syncScriptingVars(n, VariableInfo.NESTED); - } - - if (n.implementsIterationTag()) { - out.printil("do {"); - out.pushIndent(); - } - } - // Map the Java lines that handles start of custom tags to the - // JSP line for this tag - n.setEndJavaLine(out.getJavaLine()); - } - - private void generateCustomEnd(Node.CustomTag n, String tagHandlerVar, - String tagEvalVar, String tagPushBodyCountVar) { - - if (!n.hasEmptyBody()) { - if (n.implementsIterationTag()) { - out.printin("int evalDoAfterBody = "); - out.print(tagHandlerVar); - out.println(".doAfterBody();"); - - // Synchronize AT_BEGIN and NESTED scripting variables - syncScriptingVars(n, VariableInfo.AT_BEGIN); - syncScriptingVars(n, VariableInfo.NESTED); - - out - .printil("if (evalDoAfterBody != javax.servlet.jsp.tagext.BodyTag.EVAL_BODY_AGAIN)"); - out.pushIndent(); - out.printil("break;"); - out.popIndent(); - - out.popIndent(); - out.printil("} while (true);"); - } - - restoreScriptingVars(n, VariableInfo.NESTED); - - if (n.implementsBodyTag()) { - out.printin("if ("); - out.print(tagEvalVar); - out - .println(" != javax.servlet.jsp.tagext.Tag.EVAL_BODY_INCLUDE) {"); - out.pushIndent(); - out.printil("out = _jspx_page_context.popBody();"); - if (n.implementsTryCatchFinally()) { - out.printin(tagPushBodyCountVar); - out.println("[0]--;"); - } else if (pushBodyCountVar != null) { - out.printin(pushBodyCountVar); - out.println("[0]--;"); - } - out.popIndent(); - out.printil("}"); - } - - out.popIndent(); // EVAL_BODY - out.printil("}"); - } - - out.printin("if ("); - out.print(tagHandlerVar); - out - .println(".doEndTag() == javax.servlet.jsp.tagext.Tag.SKIP_PAGE) {"); - out.pushIndent(); - if (!n.implementsTryCatchFinally()) { - if (isPoolingEnabled && !(n.implementsJspIdConsumer())) { - out.printin(n.getTagHandlerPoolName()); - out.print(".reuse("); - out.print(tagHandlerVar); - out.println(");"); - } else { - out.printin(tagHandlerVar); - out.println(".release();"); - out.printin("org.apache.jasper.runtime.AnnotationHelper.preDestroy("); - out.print(VAR_ANNOTATIONPROCESSOR); - out.print(", "); - out.print(tagHandlerVar); - out.println(");"); - } - } - if (isTagFile || isFragment) { - out.printil("throw new SkipPageException();"); - } else { - out.printil((methodNesting > 0) ? "return true;" : "return;"); - } - out.popIndent(); - out.printil("}"); - // Synchronize AT_BEGIN scripting variables - syncScriptingVars(n, VariableInfo.AT_BEGIN); - - // TryCatchFinally - if (n.implementsTryCatchFinally()) { - out.popIndent(); // try - out.printil("} catch (Throwable _jspx_exception) {"); - out.pushIndent(); - - out.printin("while ("); - out.print(tagPushBodyCountVar); - out.println("[0]-- > 0)"); - out.pushIndent(); - out.printil("out = _jspx_page_context.popBody();"); - out.popIndent(); - - out.printin(tagHandlerVar); - out.println(".doCatch(_jspx_exception);"); - out.popIndent(); - out.printil("} finally {"); - out.pushIndent(); - out.printin(tagHandlerVar); - out.println(".doFinally();"); - } - - if (isPoolingEnabled && !(n.implementsJspIdConsumer())) { - out.printin(n.getTagHandlerPoolName()); - out.print(".reuse("); - out.print(tagHandlerVar); - out.println(");"); - } else { - out.printin(tagHandlerVar); - out.println(".release();"); - out.printin("org.apache.jasper.runtime.AnnotationHelper.preDestroy("); - out.print(VAR_ANNOTATIONPROCESSOR); - out.print(", "); - out.print(tagHandlerVar); - out.println(");"); - } - - if (n.implementsTryCatchFinally()) { - out.popIndent(); - out.printil("}"); - } - - // Declare and synchronize AT_END scripting variables (must do this - // outside the try/catch/finally block) - declareScriptingVars(n, VariableInfo.AT_END); - syncScriptingVars(n, VariableInfo.AT_END); - - restoreScriptingVars(n, VariableInfo.AT_BEGIN); - } - - private void generateCustomDoTag(Node.CustomTag n, - TagHandlerInfo handlerInfo, String tagHandlerVar) - throws JasperException { - - Class tagHandlerClass = handlerInfo.getTagHandlerClass(); - - n.setBeginJavaLine(out.getJavaLine()); - out.printin("// "); - out.println(n.getQName()); - - // Declare AT_BEGIN scripting variables - declareScriptingVars(n, VariableInfo.AT_BEGIN); - saveScriptingVars(n, VariableInfo.AT_BEGIN); - - String tagHandlerClassName = JspUtil - .getCanonicalName(tagHandlerClass); - out.printin(tagHandlerClassName); - out.print(" "); - out.print(tagHandlerVar); - out.print(" = "); - out.print("new "); - out.print(tagHandlerClassName); - out.println("();"); - - // Resource injection - out.printin("org.apache.jasper.runtime.AnnotationHelper.postConstruct("); - out.print(VAR_ANNOTATIONPROCESSOR); - out.print(", "); - out.print(tagHandlerVar); - out.println(");"); - - generateSetters(n, tagHandlerVar, handlerInfo, true); - - // JspIdConsumer (after context has been set) - if (n.implementsJspIdConsumer()) { - out.printin(tagHandlerVar); - out.print(".setJspId(\""); - out.print(createJspId()); - out.println("\");"); - } - - // Set the body - if (findJspBody(n) == null) { - /* - * Encapsulate body of custom tag invocation in JspFragment and - * pass it to tag handler's setJspBody(), unless tag body is - * empty - */ - if (!n.hasEmptyBody()) { - out.printin(tagHandlerVar); - out.print(".setJspBody("); - generateJspFragment(n, tagHandlerVar); - out.println(");"); - } - } else { - /* - * Body of tag is the body of the element. The visit - * method for that element is going to encapsulate that - * element's body in a JspFragment and pass it to the tag - * handler's setJspBody() - */ - String tmpTagHandlerVar = simpleTagHandlerVar; - simpleTagHandlerVar = tagHandlerVar; - boolean tmpIsSimpleTagHandler = isSimpleTagHandler; - isSimpleTagHandler = true; - visitBody(n); - simpleTagHandlerVar = tmpTagHandlerVar; - isSimpleTagHandler = tmpIsSimpleTagHandler; - } - - out.printin(tagHandlerVar); - out.println(".doTag();"); - - restoreScriptingVars(n, VariableInfo.AT_BEGIN); - - // Synchronize AT_BEGIN scripting variables - syncScriptingVars(n, VariableInfo.AT_BEGIN); - - // Declare and synchronize AT_END scripting variables - declareScriptingVars(n, VariableInfo.AT_END); - syncScriptingVars(n, VariableInfo.AT_END); - - // Resource injection - out.printin("org.apache.jasper.runtime.AnnotationHelper.preDestroy("); - out.print(VAR_ANNOTATIONPROCESSOR); - out.print(", "); - out.print(tagHandlerVar); - out.println(");"); - - n.setEndJavaLine(out.getJavaLine()); - } - - private void declareScriptingVars(Node.CustomTag n, int scope) { - - Vector vec = n.getScriptingVars(scope); - if (vec != null) { - for (int i = 0; i < vec.size(); i++) { - Object elem = vec.elementAt(i); - if (elem instanceof VariableInfo) { - VariableInfo varInfo = (VariableInfo) elem; - if (varInfo.getDeclare()) { - out.printin(varInfo.getClassName()); - out.print(" "); - out.print(varInfo.getVarName()); - out.println(" = null;"); - } - } else { - TagVariableInfo tagVarInfo = (TagVariableInfo) elem; - if (tagVarInfo.getDeclare()) { - String varName = tagVarInfo.getNameGiven(); - if (varName == null) { - varName = n.getTagData().getAttributeString( - tagVarInfo.getNameFromAttribute()); - } else if (tagVarInfo.getNameFromAttribute() != null) { - // alias - continue; - } - out.printin(tagVarInfo.getClassName()); - out.print(" "); - out.print(varName); - out.println(" = null;"); - } - } - } - } - } - - /* - * This method is called as part of the custom tag's start element. - * - * If the given custom tag has a custom nesting level greater than 0, - * save the current values of its scripting variables to temporary - * variables, so those values may be restored in the tag's end element. - * This way, the scripting variables may be synchronized by the given - * tag without affecting their original values. - */ - private void saveScriptingVars(Node.CustomTag n, int scope) { - if (n.getCustomNestingLevel() == 0) { - return; - } - - TagVariableInfo[] tagVarInfos = n.getTagVariableInfos(); - VariableInfo[] varInfos = n.getVariableInfos(); - if ((varInfos.length == 0) && (tagVarInfos.length == 0)) { - return; - } - - if (varInfos.length > 0) { - for (int i = 0; i < varInfos.length; i++) { - if (varInfos[i].getScope() != scope) - continue; - // If the scripting variable has been declared, skip codes - // for saving and restoring it. - if (n.getScriptingVars(scope).contains(varInfos[i])) - continue; - String varName = varInfos[i].getVarName(); - String tmpVarName = "_jspx_" + varName + "_" - + n.getCustomNestingLevel(); - out.printin(tmpVarName); - out.print(" = "); - out.print(varName); - out.println(";"); - } - } else { - for (int i = 0; i < tagVarInfos.length; i++) { - if (tagVarInfos[i].getScope() != scope) - continue; - // If the scripting variable has been declared, skip codes - // for saving and restoring it. - if (n.getScriptingVars(scope).contains(tagVarInfos[i])) - continue; - String varName = tagVarInfos[i].getNameGiven(); - if (varName == null) { - varName = n.getTagData().getAttributeString( - tagVarInfos[i].getNameFromAttribute()); - } else if (tagVarInfos[i].getNameFromAttribute() != null) { - // alias - continue; - } - String tmpVarName = "_jspx_" + varName + "_" - + n.getCustomNestingLevel(); - out.printin(tmpVarName); - out.print(" = "); - out.print(varName); - out.println(";"); - } - } - } - - /* - * This method is called as part of the custom tag's end element. - * - * If the given custom tag has a custom nesting level greater than 0, - * restore its scripting variables to their original values that were - * saved in the tag's start element. - */ - private void restoreScriptingVars(Node.CustomTag n, int scope) { - if (n.getCustomNestingLevel() == 0) { - return; - } - - TagVariableInfo[] tagVarInfos = n.getTagVariableInfos(); - VariableInfo[] varInfos = n.getVariableInfos(); - if ((varInfos.length == 0) && (tagVarInfos.length == 0)) { - return; - } - - if (varInfos.length > 0) { - for (int i = 0; i < varInfos.length; i++) { - if (varInfos[i].getScope() != scope) - continue; - // If the scripting variable has been declared, skip codes - // for saving and restoring it. - if (n.getScriptingVars(scope).contains(varInfos[i])) - continue; - String varName = varInfos[i].getVarName(); - String tmpVarName = "_jspx_" + varName + "_" - + n.getCustomNestingLevel(); - out.printin(varName); - out.print(" = "); - out.print(tmpVarName); - out.println(";"); - } - } else { - for (int i = 0; i < tagVarInfos.length; i++) { - if (tagVarInfos[i].getScope() != scope) - continue; - // If the scripting variable has been declared, skip codes - // for saving and restoring it. - if (n.getScriptingVars(scope).contains(tagVarInfos[i])) - continue; - String varName = tagVarInfos[i].getNameGiven(); - if (varName == null) { - varName = n.getTagData().getAttributeString( - tagVarInfos[i].getNameFromAttribute()); - } else if (tagVarInfos[i].getNameFromAttribute() != null) { - // alias - continue; - } - String tmpVarName = "_jspx_" + varName + "_" - + n.getCustomNestingLevel(); - out.printin(varName); - out.print(" = "); - out.print(tmpVarName); - out.println(";"); - } - } - } - - /* - * Synchronizes the scripting variables of the given custom tag for the - * given scope. - */ - private void syncScriptingVars(Node.CustomTag n, int scope) { - TagVariableInfo[] tagVarInfos = n.getTagVariableInfos(); - VariableInfo[] varInfos = n.getVariableInfos(); - - if ((varInfos.length == 0) && (tagVarInfos.length == 0)) { - return; - } - - if (varInfos.length > 0) { - for (int i = 0; i < varInfos.length; i++) { - if (varInfos[i].getScope() == scope) { - out.printin(varInfos[i].getVarName()); - out.print(" = ("); - out.print(varInfos[i].getClassName()); - out.print(") _jspx_page_context.findAttribute("); - out.print(quote(varInfos[i].getVarName())); - out.println(");"); - } - } - } else { - for (int i = 0; i < tagVarInfos.length; i++) { - if (tagVarInfos[i].getScope() == scope) { - String name = tagVarInfos[i].getNameGiven(); - if (name == null) { - name = n.getTagData().getAttributeString( - tagVarInfos[i].getNameFromAttribute()); - } else if (tagVarInfos[i].getNameFromAttribute() != null) { - // alias - continue; - } - out.printin(name); - out.print(" = ("); - out.print(tagVarInfos[i].getClassName()); - out.print(") _jspx_page_context.findAttribute("); - out.print(quote(name)); - out.println(");"); - } - } - } - } - - private String getJspContextVar() { - if (this.isTagFile) { - return "this.getJspContext()"; - } else { - return "_jspx_page_context"; - } - } - - private String getExpressionFactoryVar() { - return VAR_EXPRESSIONFACTORY; - } - - /* - * Creates a tag variable name by concatenating the given prefix and - * shortName and endcoded to make the resultant string a valid Java - * Identifier. - */ - private String createTagVarName(String fullName, String prefix, - String shortName) { - - String varName; - synchronized (tagVarNumbers) { - varName = prefix + "_" + shortName + "_"; - if (tagVarNumbers.get(fullName) != null) { - Integer i = (Integer) tagVarNumbers.get(fullName); - varName = varName + i.intValue(); - tagVarNumbers.put(fullName, new Integer(i.intValue() + 1)); - } else { - tagVarNumbers.put(fullName, new Integer(1)); - varName = varName + "0"; - } - } - return JspUtil.makeJavaIdentifier(varName); - } - - private String evaluateAttribute(TagHandlerInfo handlerInfo, - Node.JspAttribute attr, Node.CustomTag n, String tagHandlerVar) - throws JasperException { - - String attrValue = attr.getValue(); - if (attrValue == null) { - if (attr.isNamedAttribute()) { - if (n.checkIfAttributeIsJspFragment(attr.getName())) { - // XXX - no need to generate temporary variable here - attrValue = generateNamedAttributeJspFragment(attr - .getNamedAttributeNode(), tagHandlerVar); - } else { - attrValue = generateNamedAttributeValue(attr - .getNamedAttributeNode()); - } - } else { - return null; - } - } - - String localName = attr.getLocalName(); - - Method m = null; - Class[] c = null; - if (attr.isDynamic()) { - c = OBJECT_CLASS; - } else { - m = handlerInfo.getSetterMethod(localName); - if (m == null) { - err.jspError(n, "jsp.error.unable.to_find_method", attr - .getName()); - } - c = m.getParameterTypes(); - // XXX assert(c.length > 0) - } - - if (attr.isExpression()) { - // Do nothing - } else if (attr.isNamedAttribute()) { - if (!n.checkIfAttributeIsJspFragment(attr.getName()) - && !attr.isDynamic()) { - attrValue = convertString(c[0], attrValue, localName, - handlerInfo.getPropertyEditorClass(localName), true); - } - } else if (attr.isELInterpreterInput()) { - - // results buffer - StringBuffer sb = new StringBuffer(64); - - TagAttributeInfo tai = attr.getTagAttributeInfo(); - - // generate elContext reference - sb.append(getJspContextVar()); - sb.append(".getELContext()"); - String elContext = sb.toString(); - if (attr.getEL() != null && attr.getEL().getMapName() != null) { - sb.setLength(0); - sb.append("new org.apache.jasper.el.ELContextWrapper("); - sb.append(elContext); - sb.append(','); - sb.append(attr.getEL().getMapName()); - sb.append(')'); - elContext = sb.toString(); - } - - // reset buffer - sb.setLength(0); - - // create our mark - sb.append(n.getStart().toString()); - sb.append(" '"); - sb.append(attrValue); - sb.append('\''); - String mark = sb.toString(); - - // reset buffer - sb.setLength(0); - - // depending on type - if (attr.isDeferredInput() - || ((tai != null) && ValueExpression.class.getName().equals(tai.getTypeName()))) { - sb.append("new org.apache.jasper.el.JspValueExpression("); - sb.append(quote(mark)); - sb.append(','); - sb.append(getExpressionFactoryVar()); - sb.append(".createValueExpression("); - if (attr.getEL() != null) { // optimize - sb.append(elContext); - sb.append(','); - } - sb.append(quote(attrValue)); - sb.append(','); - sb.append(JspUtil.toJavaSourceTypeFromTld(attr.getExpectedTypeName())); - sb.append("))"); - // should the expression be evaluated before passing to - // the setter? - boolean evaluate = false; - if (tai.canBeRequestTime()) { - evaluate = true; // JSP.2.3.2 - } - if (attr.isDeferredInput()) { - evaluate = false; // JSP.2.3.3 - } - if (attr.isDeferredInput() && tai.canBeRequestTime()) { - evaluate = !attrValue.contains("#{"); // JSP.2.3.5 - } - if (evaluate) { - sb.append(".getValue("); - sb.append(getJspContextVar()); - sb.append(".getELContext()"); - sb.append(")"); - } - attrValue = sb.toString(); - } else if (attr.isDeferredMethodInput() - || ((tai != null) && MethodExpression.class.getName().equals(tai.getTypeName()))) { - sb.append("new org.apache.jasper.el.JspMethodExpression("); - sb.append(quote(mark)); - sb.append(','); - sb.append(getExpressionFactoryVar()); - sb.append(".createMethodExpression("); - sb.append(elContext); - sb.append(','); - sb.append(quote(attrValue)); - sb.append(','); - sb.append(JspUtil.toJavaSourceTypeFromTld(attr.getExpectedTypeName())); - sb.append(','); - sb.append("new Class[] {"); - - String[] p = attr.getParameterTypeNames(); - for (int i = 0; i < p.length; i++) { - sb.append(JspUtil.toJavaSourceTypeFromTld(p[i])); - sb.append(','); - } - if (p.length > 0) { - sb.setLength(sb.length() - 1); - } - - sb.append("}))"); - attrValue = sb.toString(); - } else { - // run attrValue through the expression interpreter - String mapName = (attr.getEL() != null) ? attr.getEL() - .getMapName() : null; - attrValue = attributeValueWithEL(this.isTagFile, - attrValue, c[0], mapName); - } - } else { - attrValue = convertString(c[0], attrValue, localName, - handlerInfo.getPropertyEditorClass(localName), false); - } - return attrValue; - } - - /** - * Generate code to create a map for the alias variables - * - * @return the name of the map - */ - private String generateAliasMap(Node.CustomTag n, String tagHandlerVar) - throws JasperException { - - TagVariableInfo[] tagVars = n.getTagVariableInfos(); - String aliasMapVar = null; - - boolean aliasSeen = false; - for (int i = 0; i < tagVars.length; i++) { - - String nameFrom = tagVars[i].getNameFromAttribute(); - if (nameFrom != null) { - String aliasedName = n.getAttributeValue(nameFrom); - if (aliasedName == null) - continue; - - if (!aliasSeen) { - out.printin("java.util.HashMap "); - aliasMapVar = tagHandlerVar + "_aliasMap"; - out.print(aliasMapVar); - out.println(" = new java.util.HashMap();"); - aliasSeen = true; - } - out.printin(aliasMapVar); - out.print(".put("); - out.print(quote(tagVars[i].getNameGiven())); - out.print(", "); - out.print(quote(aliasedName)); - out.println(");"); - } - } - return aliasMapVar; - } - - private void generateSetters(Node.CustomTag n, String tagHandlerVar, - TagHandlerInfo handlerInfo, boolean simpleTag) - throws JasperException { - - // Set context - if (simpleTag) { - // Generate alias map - String aliasMapVar = null; - if (n.isTagFile()) { - aliasMapVar = generateAliasMap(n, tagHandlerVar); - } - out.printin(tagHandlerVar); - if (aliasMapVar == null) { - out.println(".setJspContext(_jspx_page_context);"); - } else { - out.print(".setJspContext(_jspx_page_context, "); - out.print(aliasMapVar); - out.println(");"); - } - } else { - out.printin(tagHandlerVar); - out.println(".setPageContext(_jspx_page_context);"); - } - - // Set parent - if (isTagFile && parent == null) { - out.printin(tagHandlerVar); - out.print(".setParent("); - out.print("new javax.servlet.jsp.tagext.TagAdapter("); - out.print("(javax.servlet.jsp.tagext.SimpleTag) this ));"); - } else if (!simpleTag) { - out.printin(tagHandlerVar); - out.print(".setParent("); - if (parent != null) { - if (isSimpleTagParent) { - out.print("new javax.servlet.jsp.tagext.TagAdapter("); - out.print("(javax.servlet.jsp.tagext.SimpleTag) "); - out.print(parent); - out.println("));"); - } else { - out.print("(javax.servlet.jsp.tagext.Tag) "); - out.print(parent); - out.println(");"); - } - } else { - out.println("null);"); - } - } else { - // The setParent() method need not be called if the value being - // passed is null, since SimpleTag instances are not reused - if (parent != null) { - out.printin(tagHandlerVar); - out.print(".setParent("); - out.print(parent); - out.println(");"); - } - } - - // need to handle deferred values and methods - Node.JspAttribute[] attrs = n.getJspAttributes(); - for (int i = 0; attrs != null && i < attrs.length; i++) { - String attrValue = evaluateAttribute(handlerInfo, attrs[i], n, - tagHandlerVar); - - Mark m = n.getStart(); - out.printil("// "+m.getFile()+"("+m.getLineNumber()+","+m.getColumnNumber()+") "+ attrs[i].getTagAttributeInfo()); - if (attrs[i].isDynamic()) { - out.printin(tagHandlerVar); - out.print("."); - out.print("setDynamicAttribute("); - String uri = attrs[i].getURI(); - if ("".equals(uri) || (uri == null)) { - out.print("null"); - } else { - out.print("\"" + attrs[i].getURI() + "\""); - } - out.print(", \""); - out.print(attrs[i].getLocalName()); - out.print("\", "); - out.print(attrValue); - out.println(");"); - } else { - out.printin(tagHandlerVar); - out.print("."); - out.print(handlerInfo.getSetterMethod( - attrs[i].getLocalName()).getName()); - out.print("("); - out.print(attrValue); - out.println(");"); - } - } - } - - /* - * @param c The target class to which to coerce the given string @param - * s The string value @param attrName The name of the attribute whose - * value is being supplied @param propEditorClass The property editor - * for the given attribute @param isNamedAttribute true if the given - * attribute is a named attribute (that is, specified using the - * jsp:attribute standard action), and false otherwise - */ - private String convertString(Class c, String s, String attrName, - Class propEditorClass, boolean isNamedAttribute) - throws JasperException { - - String quoted = s; - if (!isNamedAttribute) { - quoted = quote(s); - } - - if (propEditorClass != null) { - String className = JspUtil.getCanonicalName(c); - return "(" - + className - + ")org.apache.jasper.runtime.JspRuntimeLibrary.getValueFromBeanInfoPropertyEditor(" - + className + ".class, \"" + attrName + "\", " + quoted - + ", " + JspUtil.getCanonicalName(propEditorClass) - + ".class)"; - } else if (c == String.class) { - return quoted; - } else if (c == boolean.class) { - return JspUtil.coerceToPrimitiveBoolean(s, isNamedAttribute); - } else if (c == Boolean.class) { - return JspUtil.coerceToBoolean(s, isNamedAttribute); - } else if (c == byte.class) { - return JspUtil.coerceToPrimitiveByte(s, isNamedAttribute); - } else if (c == Byte.class) { - return JspUtil.coerceToByte(s, isNamedAttribute); - } else if (c == char.class) { - return JspUtil.coerceToChar(s, isNamedAttribute); - } else if (c == Character.class) { - return JspUtil.coerceToCharacter(s, isNamedAttribute); - } else if (c == double.class) { - return JspUtil.coerceToPrimitiveDouble(s, isNamedAttribute); - } else if (c == Double.class) { - return JspUtil.coerceToDouble(s, isNamedAttribute); - } else if (c == float.class) { - return JspUtil.coerceToPrimitiveFloat(s, isNamedAttribute); - } else if (c == Float.class) { - return JspUtil.coerceToFloat(s, isNamedAttribute); - } else if (c == int.class) { - return JspUtil.coerceToInt(s, isNamedAttribute); - } else if (c == Integer.class) { - return JspUtil.coerceToInteger(s, isNamedAttribute); - } else if (c == short.class) { - return JspUtil.coerceToPrimitiveShort(s, isNamedAttribute); - } else if (c == Short.class) { - return JspUtil.coerceToShort(s, isNamedAttribute); - } else if (c == long.class) { - return JspUtil.coerceToPrimitiveLong(s, isNamedAttribute); - } else if (c == Long.class) { - return JspUtil.coerceToLong(s, isNamedAttribute); - } else if (c == Object.class) { - return "new String(" + quoted + ")"; - } else { - String className = JspUtil.getCanonicalName(c); - return "(" - + className - + ")org.apache.jasper.runtime.JspRuntimeLibrary.getValueFromPropertyEditorManager(" - + className + ".class, \"" + attrName + "\", " + quoted - + ")"; - } - } - - /* - * Converts the scope string representation, whose possible values are - * "page", "request", "session", and "application", to the corresponding - * scope constant. - */ - private String getScopeConstant(String scope) { - String scopeName = "PageContext.PAGE_SCOPE"; // Default to page - - if ("request".equals(scope)) { - scopeName = "PageContext.REQUEST_SCOPE"; - } else if ("session".equals(scope)) { - scopeName = "PageContext.SESSION_SCOPE"; - } else if ("application".equals(scope)) { - scopeName = "PageContext.APPLICATION_SCOPE"; - } - - return scopeName; - } - - /** - * Generates anonymous JspFragment inner class which is passed as an - * argument to SimpleTag.setJspBody(). - */ - private void generateJspFragment(Node n, String tagHandlerVar) - throws JasperException { - // XXX - A possible optimization here would be to check to see - // if the only child of the parent node is TemplateText. If so, - // we know there won't be any parameters, etc, so we can - // generate a low-overhead JspFragment that just echoes its - // body. The implementation of this fragment can come from - // the org.apache.jasper.runtime package as a support class. - FragmentHelperClass.Fragment fragment = fragmentHelperClass - .openFragment(n, tagHandlerVar, methodNesting); - ServletWriter outSave = out; - out = fragment.getGenBuffer().getOut(); - String tmpParent = parent; - parent = "_jspx_parent"; - boolean isSimpleTagParentSave = isSimpleTagParent; - isSimpleTagParent = true; - boolean tmpIsFragment = isFragment; - isFragment = true; - String pushBodyCountVarSave = pushBodyCountVar; - if (pushBodyCountVar != null) { - // Use a fixed name for push body count, to simplify code gen - pushBodyCountVar = "_jspx_push_body_count"; - } - visitBody(n); - out = outSave; - parent = tmpParent; - isSimpleTagParent = isSimpleTagParentSave; - isFragment = tmpIsFragment; - pushBodyCountVar = pushBodyCountVarSave; - fragmentHelperClass.closeFragment(fragment, methodNesting); - // XXX - Need to change pageContext to jspContext if - // we're not in a place where pageContext is defined (e.g. - // in a fragment or in a tag file. - out.print("new " + fragmentHelperClass.getClassName() + "( " - + fragment.getId() + ", _jspx_page_context, " - + tagHandlerVar + ", " + pushBodyCountVar + ")"); - } - - /** - * Generate the code required to obtain the runtime value of the given - * named attribute. - * - * @return The name of the temporary variable the result is stored in. - */ - public String generateNamedAttributeValue(Node.NamedAttribute n) - throws JasperException { - - String varName = n.getTemporaryVariableName(); - - // If the only body element for this named attribute node is - // template text, we need not generate an extra call to - // pushBody and popBody. Maybe we can further optimize - // here by getting rid of the temporary variable, but in - // reality it looks like javac does this for us. - Node.Nodes body = n.getBody(); - if (body != null) { - boolean templateTextOptimization = false; - if (body.size() == 1) { - Node bodyElement = body.getNode(0); - if (bodyElement instanceof Node.TemplateText) { - templateTextOptimization = true; - out.printil("String " - + varName - + " = " - + quote(new String( - ((Node.TemplateText) bodyElement) - .getText())) + ";"); - } - } - - // XXX - Another possible optimization would be for - // lone EL expressions (no need to pushBody here either). - - if (!templateTextOptimization) { - out.printil("out = _jspx_page_context.pushBody();"); - visitBody(n); - out.printil("String " + varName + " = " - + "((javax.servlet.jsp.tagext.BodyContent)" - + "out).getString();"); - out.printil("out = _jspx_page_context.popBody();"); - } - } else { - // Empty body must be treated as "" - out.printil("String " + varName + " = \"\";"); - } - - return varName; - } - - /** - * Similar to generateNamedAttributeValue, but create a JspFragment - * instead. - * - * @param n - * The parent node of the named attribute - * @param tagHandlerVar - * The variable the tag handler is stored in, so the fragment - * knows its parent tag. - * @return The name of the temporary variable the fragment is stored in. - */ - public String generateNamedAttributeJspFragment(Node.NamedAttribute n, - String tagHandlerVar) throws JasperException { - String varName = n.getTemporaryVariableName(); - - out.printin("javax.servlet.jsp.tagext.JspFragment " + varName - + " = "); - generateJspFragment(n, tagHandlerVar); - out.println(";"); - - return varName; - } - } - - private static void generateLocalVariables(ServletWriter out, Node n) - throws JasperException { - Node.ChildInfo ci; - if (n instanceof Node.CustomTag) { - ci = ((Node.CustomTag) n).getChildInfo(); - } else if (n instanceof Node.JspBody) { - ci = ((Node.JspBody) n).getChildInfo(); - } else if (n instanceof Node.NamedAttribute) { - ci = ((Node.NamedAttribute) n).getChildInfo(); - } else { - // Cannot access err since this method is static, but at - // least flag an error. - throw new JasperException("Unexpected Node Type"); - // err.getString( - // "jsp.error.internal.unexpected_node_type" ) ); - } - - if (ci.hasUseBean()) { - out - .printil("HttpSession session = _jspx_page_context.getSession();"); - out - .printil("ServletContext application = _jspx_page_context.getServletContext();"); - } - if (ci.hasUseBean() || ci.hasIncludeAction() || ci.hasSetProperty() - || ci.hasParamAction()) { - out - .printil("HttpServletRequest request = (HttpServletRequest)_jspx_page_context.getRequest();"); - } - if (ci.hasIncludeAction()) { - out - .printil("HttpServletResponse response = (HttpServletResponse)_jspx_page_context.getResponse();"); - } - } - - /** - * Common part of postamble, shared by both servlets and tag files. - */ - private void genCommonPostamble() { - // Append any methods that were generated in the buffer. - for (int i = 0; i < methodsBuffered.size(); i++) { - GenBuffer methodBuffer = (GenBuffer) methodsBuffered.get(i); - methodBuffer.adjustJavaLines(out.getJavaLine() - 1); - out.printMultiLn(methodBuffer.toString()); - } - - // Append the helper class - if (fragmentHelperClass.isUsed()) { - fragmentHelperClass.generatePostamble(); - fragmentHelperClass.adjustJavaLines(out.getJavaLine() - 1); - out.printMultiLn(fragmentHelperClass.toString()); - } - - // Append char array declarations - if (charArrayBuffer != null) { - out.printMultiLn(charArrayBuffer.toString()); - } - - // Close the class definition - out.popIndent(); - out.printil("}"); - } - - /** - * Generates the ending part of the static portion of the servlet. - */ - private void generatePostamble(Node.Nodes page) { - out.popIndent(); - out.printil("} catch (Throwable t) {"); - out.pushIndent(); - out.printil("if (!(t instanceof SkipPageException)){"); - out.pushIndent(); - out.printil("out = _jspx_out;"); - out.printil("if (out != null && out.getBufferSize() != 0)"); - out.pushIndent(); - out.printil("try { out.clearBuffer(); } catch (java.io.IOException e) {}"); - out.popIndent(); - - out - .printil("if (_jspx_page_context != null) _jspx_page_context.handlePageException(t);"); - out.popIndent(); - out.printil("}"); - out.popIndent(); - out.printil("} finally {"); - out.pushIndent(); - - out - .printil("_jspxFactory.releasePageContext(_jspx_page_context);"); - - out.popIndent(); - out.printil("}"); - - // Close the service method - out.popIndent(); - out.printil("}"); - - // Generated methods, helper classes, etc. - genCommonPostamble(); - } - - /** - * Constructor. - */ - Generator(ServletWriter out, Compiler compiler) { - this.out = out; - methodsBuffered = new ArrayList(); - charArrayBuffer = null; - err = compiler.getErrorDispatcher(); - ctxt = compiler.getCompilationContext(); - fragmentHelperClass = new FragmentHelperClass("Helper"); - pageInfo = compiler.getPageInfo(); - - /* - * Temporary hack. If a JSP page uses the "extends" attribute of the - * page directive, the _jspInit() method of the generated servlet class - * will not be called (it is only called for those generated servlets - * that extend HttpJspBase, the default), causing the tag handler pools - * not to be initialized and resulting in a NPE. The JSP spec needs to - * clarify whether containers can override init() and destroy(). For - * now, we just disable tag pooling for pages that use "extends". - */ - if (pageInfo.getExtends(false) == null) { - isPoolingEnabled = ctxt.getOptions().isPoolingEnabled(); - } else { - isPoolingEnabled = false; - } - beanInfo = pageInfo.getBeanRepository(); - breakAtLF = ctxt.getOptions().getMappedFile(); - if (isPoolingEnabled) { - tagHandlerPoolNames = new Vector(); - } - } - - /** - * The main entry for Generator. - * - * @param out - * The servlet output writer - * @param compiler - * The compiler - * @param page - * The input page - */ - public static void generate(ServletWriter out, Compiler compiler, - Node.Nodes page) throws JasperException { - - Generator gen = new Generator(out, compiler); - - if (gen.isPoolingEnabled) { - gen.compileTagHandlerPoolList(page); - } - if (gen.ctxt.isTagFile()) { - JasperTagInfo tagInfo = (JasperTagInfo) gen.ctxt.getTagInfo(); - gen.generateTagHandlerPreamble(tagInfo, page); - - if (gen.ctxt.isPrototypeMode()) { - return; - } - - gen.generateXmlProlog(page); - gen.fragmentHelperClass.generatePreamble(); - page.visit(gen.new GenerateVisitor(gen.ctxt.isTagFile(), out, - gen.methodsBuffered, gen.fragmentHelperClass, gen.ctxt - .getClassLoader(), tagInfo)); - gen.generateTagHandlerPostamble(tagInfo); - } else { - gen.generatePreamble(page); - gen.generateXmlProlog(page); - gen.fragmentHelperClass.generatePreamble(); - page.visit(gen.new GenerateVisitor(gen.ctxt.isTagFile(), out, - gen.methodsBuffered, gen.fragmentHelperClass, gen.ctxt - .getClassLoader(), null)); - gen.generatePostamble(page); - } - } - - /* - * Generates tag handler preamble. - */ - private void generateTagHandlerPreamble(JasperTagInfo tagInfo, - Node.Nodes tag) throws JasperException { - - // Generate package declaration - String className = tagInfo.getTagClassName(); - int lastIndex = className.lastIndexOf('.'); - if (lastIndex != -1) { - String pkgName = className.substring(0, lastIndex); - genPreamblePackage(pkgName); - className = className.substring(lastIndex + 1); - } - - // Generate imports - genPreambleImports(); - - // Generate class declaration - out.printin("public final class "); - out.println(className); - out.printil(" extends javax.servlet.jsp.tagext.SimpleTagSupport"); - out.printin(" implements org.apache.jasper.runtime.JspSourceDependent"); - if (tagInfo.hasDynamicAttributes()) { - out.println(","); - out.printin(" javax.servlet.jsp.tagext.DynamicAttributes"); - } - out.println(" {"); - out.println(); - out.pushIndent(); - - /* - * Class body begins here - */ - generateDeclarations(tag); - - // Static initializations here - genPreambleStaticInitializers(); - - out.printil("private JspContext jspContext;"); - - // Declare writer used for storing result of fragment/body invocation - // if 'varReader' or 'var' attribute is specified - out.printil("private java.io.Writer _jspx_sout;"); - - // Class variable declarations - genPreambleClassVariableDeclarations(tagInfo.getTagName()); - - generateSetJspContext(tagInfo); - - // Tag-handler specific declarations - generateTagHandlerAttributes(tagInfo); - if (tagInfo.hasDynamicAttributes()) - generateSetDynamicAttribute(); - - // Methods here - genPreambleMethods(); - - // Now the doTag() method - out.printil("public void doTag() throws JspException, java.io.IOException {"); - - if (ctxt.isPrototypeMode()) { - out.printil("}"); - out.popIndent(); - out.printil("}"); - return; - } - - out.pushIndent(); - - /* - * According to the spec, 'pageContext' must not be made available as an - * implicit object in tag files. Declare _jspx_page_context, so we can - * share the code generator with JSPs. - */ - out.printil("PageContext _jspx_page_context = (PageContext)jspContext;"); - - // Declare implicit objects. - out.printil("HttpServletRequest request = " - + "(HttpServletRequest) _jspx_page_context.getRequest();"); - out.printil("HttpServletResponse response = " - + "(HttpServletResponse) _jspx_page_context.getResponse();"); - out.printil("HttpSession session = _jspx_page_context.getSession();"); - out.printil("ServletContext application = _jspx_page_context.getServletContext();"); - out.printil("ServletConfig config = _jspx_page_context.getServletConfig();"); - out.printil("JspWriter out = jspContext.getOut();"); - out.printil("_jspInit(config);"); - - // set current JspContext on ELContext - out.printil("jspContext.getELContext().putContext(JspContext.class,jspContext);"); - - generatePageScopedVariables(tagInfo); - - declareTemporaryScriptingVars(tag); - out.println(); - - out.printil("try {"); - out.pushIndent(); - } - - private void generateTagHandlerPostamble(TagInfo tagInfo) { - out.popIndent(); - - // Have to catch Throwable because a classic tag handler - // helper method is declared to throw Throwable. - out.printil("} catch( Throwable t ) {"); - out.pushIndent(); - out.printil("if( t instanceof SkipPageException )"); - out.printil(" throw (SkipPageException) t;"); - out.printil("if( t instanceof java.io.IOException )"); - out.printil(" throw (java.io.IOException) t;"); - out.printil("if( t instanceof IllegalStateException )"); - out.printil(" throw (IllegalStateException) t;"); - out.printil("if( t instanceof JspException )"); - out.printil(" throw (JspException) t;"); - out.printil("throw new JspException(t);"); - out.popIndent(); - out.printil("} finally {"); - out.pushIndent(); - - // handle restoring VariableMapper - TagAttributeInfo[] attrInfos = tagInfo.getAttributes(); - for (int i = 0; i < attrInfos.length; i++) { - if (attrInfos[i].isDeferredMethod() || attrInfos[i].isDeferredValue()) { - out.printin("_el_variablemapper.setVariable("); - out.print(quote(attrInfos[i].getName())); - out.print(",_el_ve"); - out.print(i); - out.println(");"); - } - } - - // restore nested JspContext on ELContext - out.printil("jspContext.getELContext().putContext(JspContext.class,super.getJspContext());"); - - out.printil("((org.apache.jasper.runtime.JspContextWrapper) jspContext).syncEndTagFile();"); - if (isPoolingEnabled && !tagHandlerPoolNames.isEmpty()) { - out.printil("_jspDestroy();"); - } - out.popIndent(); - out.printil("}"); - - // Close the doTag method - out.popIndent(); - out.printil("}"); - - // Generated methods, helper classes, etc. - genCommonPostamble(); - } - - /** - * Generates declarations for tag handler attributes, and defines the getter - * and setter methods for each. - */ - private void generateTagHandlerAttributes(TagInfo tagInfo) - throws JasperException { - - if (tagInfo.hasDynamicAttributes()) { - out.printil("private java.util.HashMap _jspx_dynamic_attrs = new java.util.HashMap();"); - } - - // Declare attributes - TagAttributeInfo[] attrInfos = tagInfo.getAttributes(); - for (int i = 0; i < attrInfos.length; i++) { - out.printin("private "); - if (attrInfos[i].isFragment()) { - out.print("javax.servlet.jsp.tagext.JspFragment "); - } else { - out.print(JspUtil.toJavaSourceType(attrInfos[i].getTypeName())); - out.print(" "); - } - out.print(attrInfos[i].getName()); - out.println(";"); - } - out.println(); - - // Define attribute getter and setter methods - if (attrInfos != null) { - for (int i = 0; i < attrInfos.length; i++) { - // getter method - out.printin("public "); - if (attrInfos[i].isFragment()) { - out.print("javax.servlet.jsp.tagext.JspFragment "); - } else { - out.print(JspUtil.toJavaSourceType(attrInfos[i] - .getTypeName())); - out.print(" "); - } - out.print(toGetterMethod(attrInfos[i].getName())); - out.println(" {"); - out.pushIndent(); - out.printin("return this."); - out.print(attrInfos[i].getName()); - out.println(";"); - out.popIndent(); - out.printil("}"); - out.println(); - - // setter method - out.printin("public void "); - out.print(toSetterMethodName(attrInfos[i].getName())); - if (attrInfos[i].isFragment()) { - out.print("(javax.servlet.jsp.tagext.JspFragment "); - } else { - out.print("("); - out.print(JspUtil.toJavaSourceType(attrInfos[i] - .getTypeName())); - out.print(" "); - } - out.print(attrInfos[i].getName()); - out.println(") {"); - out.pushIndent(); - out.printin("this."); - out.print(attrInfos[i].getName()); - out.print(" = "); - out.print(attrInfos[i].getName()); - out.println(";"); - if (ctxt.isTagFile()) { - // Tag files should also set jspContext attributes - out.printin("jspContext.setAttribute(\""); - out.print(attrInfos[i].getName()); - out.print("\", "); - out.print(attrInfos[i].getName()); - out.println(");"); - } - out.popIndent(); - out.printil("}"); - out.println(); - } - } - } - - /* - * Generate setter for JspContext so we can create a wrapper and store both - * the original and the wrapper. We need the wrapper to mask the page - * context from the tag file and simulate a fresh page context. We need the - * original to do things like sync AT_BEGIN and AT_END scripting variables. - */ - private void generateSetJspContext(TagInfo tagInfo) { - - boolean nestedSeen = false; - boolean atBeginSeen = false; - boolean atEndSeen = false; - - // Determine if there are any aliases - boolean aliasSeen = false; - TagVariableInfo[] tagVars = tagInfo.getTagVariableInfos(); - for (int i = 0; i < tagVars.length; i++) { - if (tagVars[i].getNameFromAttribute() != null - && tagVars[i].getNameGiven() != null) { - aliasSeen = true; - break; - } - } - - if (aliasSeen) { - out - .printil("public void setJspContext(JspContext ctx, java.util.Map aliasMap) {"); - } else { - out.printil("public void setJspContext(JspContext ctx) {"); - } - out.pushIndent(); - out.printil("super.setJspContext(ctx);"); - out.printil("java.util.ArrayList _jspx_nested = null;"); - out.printil("java.util.ArrayList _jspx_at_begin = null;"); - out.printil("java.util.ArrayList _jspx_at_end = null;"); - - for (int i = 0; i < tagVars.length; i++) { - - switch (tagVars[i].getScope()) { - case VariableInfo.NESTED: - if (!nestedSeen) { - out.printil("_jspx_nested = new java.util.ArrayList();"); - nestedSeen = true; - } - out.printin("_jspx_nested.add("); - break; - - case VariableInfo.AT_BEGIN: - if (!atBeginSeen) { - out.printil("_jspx_at_begin = new java.util.ArrayList();"); - atBeginSeen = true; - } - out.printin("_jspx_at_begin.add("); - break; - - case VariableInfo.AT_END: - if (!atEndSeen) { - out.printil("_jspx_at_end = new java.util.ArrayList();"); - atEndSeen = true; - } - out.printin("_jspx_at_end.add("); - break; - } // switch - - out.print(quote(tagVars[i].getNameGiven())); - out.println(");"); - } - if (aliasSeen) { - out - .printil("this.jspContext = new org.apache.jasper.runtime.JspContextWrapper(ctx, _jspx_nested, _jspx_at_begin, _jspx_at_end, aliasMap);"); - } else { - out - .printil("this.jspContext = new org.apache.jasper.runtime.JspContextWrapper(ctx, _jspx_nested, _jspx_at_begin, _jspx_at_end, null);"); - } - out.popIndent(); - out.printil("}"); - out.println(); - out.printil("public JspContext getJspContext() {"); - out.pushIndent(); - out.printil("return this.jspContext;"); - out.popIndent(); - out.printil("}"); - } - - /* - * Generates implementation of - * javax.servlet.jsp.tagext.DynamicAttributes.setDynamicAttribute() method, - * which saves each dynamic attribute that is passed in so that a scoped - * variable can later be created for it. - */ - public void generateSetDynamicAttribute() { - out - .printil("public void setDynamicAttribute(String uri, String localName, Object value) throws JspException {"); - out.pushIndent(); - /* - * According to the spec, only dynamic attributes with no uri are to be - * present in the Map; all other dynamic attributes are ignored. - */ - out.printil("if (uri == null)"); - out.pushIndent(); - out.printil("_jspx_dynamic_attrs.put(localName, value);"); - out.popIndent(); - out.popIndent(); - out.printil("}"); - } - - /* - * Creates a page-scoped variable for each declared tag attribute. Also, if - * the tag accepts dynamic attributes, a page-scoped variable is made - * available for each dynamic attribute that was passed in. - */ - private void generatePageScopedVariables(JasperTagInfo tagInfo) { - - // "normal" attributes - TagAttributeInfo[] attrInfos = tagInfo.getAttributes(); - boolean variableMapperVar = false; - for (int i = 0; i < attrInfos.length; i++) { - String attrName = attrInfos[i].getName(); - - // handle assigning deferred vars to VariableMapper, storing - // previous values under '_el_ve[i]' for later re-assignment - if (attrInfos[i].isDeferredValue() || attrInfos[i].isDeferredMethod()) { - - // we need to scope the modified VariableMapper for consistency and performance - if (!variableMapperVar) { - out.printil("javax.el.VariableMapper _el_variablemapper = jspContext.getELContext().getVariableMapper();"); - variableMapperVar = true; - } - - out.printin("javax.el.ValueExpression _el_ve"); - out.print(i); - out.print(" = _el_variablemapper.setVariable("); - out.print(quote(attrName)); - out.print(','); - if (attrInfos[i].isDeferredMethod()) { - out.print(VAR_EXPRESSIONFACTORY); - out.print(".createValueExpression("); - out.print(toGetterMethod(attrName)); - out.print(",javax.el.MethodExpression.class)"); - } else { - out.print(toGetterMethod(attrName)); - } - out.println(");"); - } else { - out.printil("if( " + toGetterMethod(attrName) + " != null ) "); - out.pushIndent(); - out.printin("_jspx_page_context.setAttribute("); - out.print(quote(attrName)); - out.print(", "); - out.print(toGetterMethod(attrName)); - out.println(");"); - out.popIndent(); - } - } - - // Expose the Map containing dynamic attributes as a page-scoped var - if (tagInfo.hasDynamicAttributes()) { - out.printin("_jspx_page_context.setAttribute(\""); - out.print(tagInfo.getDynamicAttributesMapName()); - out.print("\", _jspx_dynamic_attrs);"); - } - } - - /* - * Generates the getter method for the given attribute name. - */ - private String toGetterMethod(String attrName) { - char[] attrChars = attrName.toCharArray(); - attrChars[0] = Character.toUpperCase(attrChars[0]); - return "get" + new String(attrChars) + "()"; - } - - /* - * Generates the setter method name for the given attribute name. - */ - private String toSetterMethodName(String attrName) { - char[] attrChars = attrName.toCharArray(); - attrChars[0] = Character.toUpperCase(attrChars[0]); - return "set" + new String(attrChars); - } - - /** - * Class storing the result of introspecting a custom tag handler. - */ - private static class TagHandlerInfo { - - private Hashtable methodMaps; - - private Hashtable propertyEditorMaps; - - private Class tagHandlerClass; - - /** - * Constructor. - * - * @param n - * The custom tag whose tag handler class is to be - * introspected - * @param tagHandlerClass - * Tag handler class - * @param err - * Error dispatcher - */ - TagHandlerInfo(Node n, Class tagHandlerClass, ErrorDispatcher err) - throws JasperException { - this.tagHandlerClass = tagHandlerClass; - this.methodMaps = new Hashtable(); - this.propertyEditorMaps = new Hashtable(); - - try { - BeanInfo tagClassInfo = Introspector - .getBeanInfo(tagHandlerClass); - PropertyDescriptor[] pd = tagClassInfo.getPropertyDescriptors(); - for (int i = 0; i < pd.length; i++) { - /* - * FIXME: should probably be checking for things like - * pageContext, bodyContent, and parent here -akv - */ - if (pd[i].getWriteMethod() != null) { - methodMaps.put(pd[i].getName(), pd[i].getWriteMethod()); - } - if (pd[i].getPropertyEditorClass() != null) - propertyEditorMaps.put(pd[i].getName(), pd[i] - .getPropertyEditorClass()); - } - } catch (IntrospectionException ie) { - err.jspError(n, "jsp.error.introspect.taghandler", - tagHandlerClass.getName(), ie); - } - } - - /** - * XXX - */ - public Method getSetterMethod(String attrName) { - return (Method) methodMaps.get(attrName); - } - - /** - * XXX - */ - public Class getPropertyEditorClass(String attrName) { - return (Class) propertyEditorMaps.get(attrName); - } - - /** - * XXX - */ - public Class getTagHandlerClass() { - return tagHandlerClass; - } - } - - /** - * A class for generating codes to a buffer. Included here are some support - * for tracking source to Java lines mapping. - */ - private static class GenBuffer { - - /* - * For a CustomTag, the codes that are generated at the beginning of the - * tag may not be in the same buffer as those for the body of the tag. - * Two fields are used here to keep this straight. For codes that do not - * corresponds to any JSP lines, they should be null. - */ - private Node node; - - private Node.Nodes body; - - private java.io.CharArrayWriter charWriter; - - protected ServletWriter out; - - GenBuffer() { - this(null, null); - } - - GenBuffer(Node n, Node.Nodes b) { - node = n; - body = b; - if (body != null) { - body.setGeneratedInBuffer(true); - } - charWriter = new java.io.CharArrayWriter(); - out = new ServletWriter(new java.io.PrintWriter(charWriter)); - } - - public ServletWriter getOut() { - return out; - } - - public String toString() { - return charWriter.toString(); - } - - /** - * Adjust the Java Lines. This is necessary because the Java lines - * stored with the nodes are relative the beginning of this buffer and - * need to be adjusted when this buffer is inserted into the source. - */ - public void adjustJavaLines(final int offset) { - - if (node != null) { - adjustJavaLine(node, offset); - } - - if (body != null) { - try { - body.visit(new Node.Visitor() { - - public void doVisit(Node n) { - adjustJavaLine(n, offset); - } - - public void visit(Node.CustomTag n) - throws JasperException { - Node.Nodes b = n.getBody(); - if (b != null && !b.isGeneratedInBuffer()) { - // Don't adjust lines for the nested tags that - // are also generated in buffers, because the - // adjustments will be done elsewhere. - b.visit(this); - } - } - }); - } catch (JasperException ex) { - } - } - } - - private static void adjustJavaLine(Node n, int offset) { - if (n.getBeginJavaLine() > 0) { - n.setBeginJavaLine(n.getBeginJavaLine() + offset); - n.setEndJavaLine(n.getEndJavaLine() + offset); - } - } - } - - /** - * Keeps track of the generated Fragment Helper Class - */ - private static class FragmentHelperClass { - - private static class Fragment { - private GenBuffer genBuffer; - - private int id; - - public Fragment(int id, Node node) { - this.id = id; - genBuffer = new GenBuffer(null, node.getBody()); - } - - public GenBuffer getGenBuffer() { - return this.genBuffer; - } - - public int getId() { - return this.id; - } - } - - // True if the helper class should be generated. - private boolean used = false; - - private ArrayList fragments = new ArrayList(); - - private String className; - - // Buffer for entire helper class - private GenBuffer classBuffer = new GenBuffer(); - - public FragmentHelperClass(String className) { - this.className = className; - } - - public String getClassName() { - return this.className; - } - - public boolean isUsed() { - return this.used; - } - - public void generatePreamble() { - ServletWriter out = this.classBuffer.getOut(); - out.println(); - out.pushIndent(); - // Note: cannot be static, as we need to reference things like - // _jspx_meth_* - out.printil("private class " + className); - out.printil(" extends " - + "org.apache.jasper.runtime.JspFragmentHelper"); - out.printil("{"); - out.pushIndent(); - out - .printil("private javax.servlet.jsp.tagext.JspTag _jspx_parent;"); - out.printil("private int[] _jspx_push_body_count;"); - out.println(); - out.printil("public " + className - + "( int discriminator, JspContext jspContext, " - + "javax.servlet.jsp.tagext.JspTag _jspx_parent, " - + "int[] _jspx_push_body_count ) {"); - out.pushIndent(); - out.printil("super( discriminator, jspContext, _jspx_parent );"); - out.printil("this._jspx_parent = _jspx_parent;"); - out.printil("this._jspx_push_body_count = _jspx_push_body_count;"); - out.popIndent(); - out.printil("}"); - } - - public Fragment openFragment(Node parent, String tagHandlerVar, - int methodNesting) throws JasperException { - Fragment result = new Fragment(fragments.size(), parent); - fragments.add(result); - this.used = true; - parent.setInnerClassName(className); - - ServletWriter out = result.getGenBuffer().getOut(); - out.pushIndent(); - out.pushIndent(); - // XXX - Returns boolean because if a tag is invoked from - // within this fragment, the Generator sometimes might - // generate code like "return true". This is ignored for now, - // meaning only the fragment is skipped. The JSR-152 - // expert group is currently discussing what to do in this case. - // See comment in closeFragment() - if (methodNesting > 0) { - out.printin("public boolean invoke"); - } else { - out.printin("public void invoke"); - } - out.println(result.getId() + "( " + "JspWriter out ) "); - out.pushIndent(); - // Note: Throwable required because methods like _jspx_meth_* - // throw Throwable. - out.printil("throws Throwable"); - out.popIndent(); - out.printil("{"); - out.pushIndent(); - generateLocalVariables(out, parent); - - return result; - } - - public void closeFragment(Fragment fragment, int methodNesting) { - ServletWriter out = fragment.getGenBuffer().getOut(); - // XXX - See comment in openFragment() - if (methodNesting > 0) { - out.printil("return false;"); - } else { - out.printil("return;"); - } - out.popIndent(); - out.printil("}"); - } - - public void generatePostamble() { - ServletWriter out = this.classBuffer.getOut(); - // Generate all fragment methods: - for (int i = 0; i < fragments.size(); i++) { - Fragment fragment = (Fragment) fragments.get(i); - fragment.getGenBuffer().adjustJavaLines(out.getJavaLine() - 1); - out.printMultiLn(fragment.getGenBuffer().toString()); - } - - // Generate postamble: - out.printil("public void invoke( java.io.Writer writer )"); - out.pushIndent(); - out.printil("throws JspException"); - out.popIndent(); - out.printil("{"); - out.pushIndent(); - out.printil("JspWriter out = null;"); - out.printil("if( writer != null ) {"); - out.pushIndent(); - out.printil("out = this.jspContext.pushBody(writer);"); - out.popIndent(); - out.printil("} else {"); - out.pushIndent(); - out.printil("out = this.jspContext.getOut();"); - out.popIndent(); - out.printil("}"); - out.printil("try {"); - out.pushIndent(); - out.printil("this.jspContext.getELContext().putContext(JspContext.class,this.jspContext);"); - out.printil("switch( this.discriminator ) {"); - out.pushIndent(); - for (int i = 0; i < fragments.size(); i++) { - out.printil("case " + i + ":"); - out.pushIndent(); - out.printil("invoke" + i + "( out );"); - out.printil("break;"); - out.popIndent(); - } - out.popIndent(); - out.printil("}"); // switch - out.popIndent(); - out.printil("}"); // try - out.printil("catch( Throwable e ) {"); - out.pushIndent(); - out.printil("if (e instanceof SkipPageException)"); - out.printil(" throw (SkipPageException) e;"); - out.printil("throw new JspException( e );"); - out.popIndent(); - out.printil("}"); // catch - out.printil("finally {"); - out.pushIndent(); - - out.printil("if( writer != null ) {"); - out.pushIndent(); - out.printil("this.jspContext.popBody();"); - out.popIndent(); - out.printil("}"); - - out.popIndent(); - out.printil("}"); // finally - out.popIndent(); - out.printil("}"); // invoke method - out.popIndent(); - out.printil("}"); // helper class - out.popIndent(); - } - - public String toString() { - return classBuffer.toString(); - } - - public void adjustJavaLines(int offset) { - for (int i = 0; i < fragments.size(); i++) { - Fragment fragment = (Fragment) fragments.get(i); - fragment.getGenBuffer().adjustJavaLines(offset); - } - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ImplicitTagLibraryInfo.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ImplicitTagLibraryInfo.java deleted file mode 100644 index de41ab545..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ImplicitTagLibraryInfo.java +++ /dev/null @@ -1,218 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.InputStream; -import java.util.Collection; -import java.util.Hashtable; -import java.util.Iterator; -import java.util.Set; -import java.util.Vector; - -import javax.servlet.jsp.tagext.FunctionInfo; -import javax.servlet.jsp.tagext.TagFileInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagLibraryInfo; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.xmlparser.ParserUtils; -import org.apache.jasper.xmlparser.TreeNode; - -/** - * Class responsible for generating an implicit tag library containing tag - * handlers corresponding to the tag files in "/WEB-INF/tags/" or a - * subdirectory of it. - * - * @author Jan Luehe - */ -class ImplicitTagLibraryInfo extends TagLibraryInfo { - - private static final String WEB_INF_TAGS = "/WEB-INF/tags"; - private static final String TAG_FILE_SUFFIX = ".tag"; - private static final String TAGX_FILE_SUFFIX = ".tagx"; - private static final String TAGS_SHORTNAME = "tags"; - private static final String TLIB_VERSION = "1.0"; - private static final String JSP_VERSION = "2.0"; - private static final String IMPLICIT_TLD = "implicit.tld"; - - // Maps tag names to tag file paths - private Hashtable tagFileMap; - - private ParserController pc; - private PageInfo pi; - private Vector vec; - - /** - * Constructor. - */ - public ImplicitTagLibraryInfo(JspCompilationContext ctxt, - ParserController pc, - PageInfo pi, - String prefix, - String tagdir, - ErrorDispatcher err) throws JasperException { - super(prefix, null); - this.pc = pc; - this.pi = pi; - this.tagFileMap = new Hashtable(); - this.vec = new Vector(); - - // Implicit tag libraries have no functions: - this.functions = new FunctionInfo[0]; - - tlibversion = TLIB_VERSION; - jspversion = JSP_VERSION; - - if (!tagdir.startsWith(WEB_INF_TAGS)) { - err.jspError("jsp.error.invalid.tagdir", tagdir); - } - - // Determine the value of the subelement of the - // "imaginary" element - if (tagdir.equals(WEB_INF_TAGS) - || tagdir.equals( WEB_INF_TAGS + "/")) { - shortname = TAGS_SHORTNAME; - } else { - shortname = tagdir.substring(WEB_INF_TAGS.length()); - shortname = shortname.replace('/', '-'); - } - - // Populate mapping of tag names to tag file paths - Set dirList = ctxt.getResourcePaths(tagdir); - if (dirList != null) { - Iterator it = dirList.iterator(); - while (it.hasNext()) { - String path = (String) it.next(); - if (path.endsWith(TAG_FILE_SUFFIX) - || path.endsWith(TAGX_FILE_SUFFIX)) { - /* - * Use the filename of the tag file, without the .tag or - * .tagx extension, respectively, as the subelement - * of the "imaginary" element - */ - String suffix = path.endsWith(TAG_FILE_SUFFIX) ? - TAG_FILE_SUFFIX : TAGX_FILE_SUFFIX; - String tagName = path.substring(path.lastIndexOf("/") + 1); - tagName = tagName.substring(0, - tagName.lastIndexOf(suffix)); - tagFileMap.put(tagName, path); - } else if (path.endsWith(IMPLICIT_TLD)) { - InputStream in = null; - try { - in = ctxt.getResourceAsStream(path); - if (in != null) { - - // Add implicit TLD to dependency list - if (pi != null) { - pi.addDependant(path); - } - - ParserUtils pu = new ParserUtils(); - TreeNode tld = pu.parseXMLDocument(uri, in); - - if (tld.findAttribute("version") != null) { - this.jspversion = tld.findAttribute("version"); - } - - // Process each child element of our element - Iterator list = tld.findChildren(); - - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - - if ("tlibversion".equals(tname) // JSP 1.1 - || "tlib-version".equals(tname)) { // JSP 1.2 - this.tlibversion = element.getBody(); - } else if ("jspversion".equals(tname) - || "jsp-version".equals(tname)) { - this.jspversion = element.getBody(); - } else if ("shortname".equals(tname) || "short-name".equals(tname)) { - // Ignore - } else { - // All other elements are invalid - err.jspError("jsp.error.invalid.implicit", path); - } - } - try { - double version = Double.parseDouble(this.jspversion); - if (version < 2.0) { - err.jspError("jsp.error.invalid.implicit.version", path); - } - } catch (NumberFormatException e) { - err.jspError("jsp.error.invalid.implicit.version", path); - } - } - } finally { - if (in != null) { - try { - in.close(); - } catch (Throwable t) { - } - } - } - } - } - } - - } - - /** - * Checks to see if the given tag name maps to a tag file path, - * and if so, parses the corresponding tag file. - * - * @return The TagFileInfo corresponding to the given tag name, or null if - * the given tag name is not implemented as a tag file - */ - public TagFileInfo getTagFile(String shortName) { - - TagFileInfo tagFile = super.getTagFile(shortName); - if (tagFile == null) { - String path = (String) tagFileMap.get(shortName); - if (path == null) { - return null; - } - - TagInfo tagInfo = null; - try { - tagInfo = TagFileProcessor.parseTagFileDirectives(pc, - shortName, - path, - pc.getJspCompilationContext().getTagFileJarUrl(path), - this); - } catch (JasperException je) { - throw new RuntimeException(je.toString(), je); - } - - tagFile = new TagFileInfo(shortName, path, tagInfo); - vec.addElement(tagFile); - - this.tagFiles = new TagFileInfo[vec.size()]; - vec.copyInto(this.tagFiles); - } - - return tagFile; - } - - public TagLibraryInfo[] getTagLibraryInfos() { - Collection coll = pi.getTaglibs(); - return (TagLibraryInfo[]) coll.toArray(new TagLibraryInfo[0]); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JDTCompiler.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JDTCompiler.java deleted file mode 100644 index fea1147b8..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JDTCompiler.java +++ /dev/null @@ -1,460 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.BufferedOutputStream; -import java.io.BufferedReader; -import java.io.ByteArrayOutputStream; -import java.io.File; -import java.io.FileInputStream; -import java.io.FileNotFoundException; -import java.io.FileOutputStream; -import java.io.IOException; -import java.io.InputStream; -import java.io.InputStreamReader; -import java.io.Reader; -import java.util.ArrayList; -import java.util.HashMap; -import java.util.Locale; -import java.util.Map; -import java.util.StringTokenizer; - -import org.apache.jasper.JasperException; -import org.eclipse.jdt.core.compiler.IProblem; -import org.eclipse.jdt.internal.compiler.ClassFile; -import org.eclipse.jdt.internal.compiler.CompilationResult; -import org.eclipse.jdt.internal.compiler.Compiler; -import org.eclipse.jdt.internal.compiler.DefaultErrorHandlingPolicies; -import org.eclipse.jdt.internal.compiler.ICompilerRequestor; -import org.eclipse.jdt.internal.compiler.IErrorHandlingPolicy; -import org.eclipse.jdt.internal.compiler.IProblemFactory; -import org.eclipse.jdt.internal.compiler.classfmt.ClassFileReader; -import org.eclipse.jdt.internal.compiler.env.ICompilationUnit; -import org.eclipse.jdt.internal.compiler.env.INameEnvironment; -import org.eclipse.jdt.internal.compiler.env.NameEnvironmentAnswer; -import org.eclipse.jdt.internal.compiler.impl.CompilerOptions; -import org.eclipse.jdt.internal.compiler.problem.DefaultProblemFactory; - -/** - * JDT class compiler. This compiler will load source dependencies from the - * context classloader, reducing dramatically disk access during - * the compilation process. - * - * @author Cocoon2 - * @author Remy Maucherat - */ -public class JDTCompiler extends org.apache.jasper.compiler.Compiler { - - - /** - * Compile the servlet from .java file to .class file - */ - protected void generateClass(String[] smap) - throws FileNotFoundException, JasperException, Exception { - - long t1 = 0; - if (log.isDebugEnabled()) { - t1 = System.currentTimeMillis(); - } - - final String sourceFile = ctxt.getServletJavaFileName(); - final String outputDir = ctxt.getOptions().getScratchDir().getAbsolutePath(); - String packageName = ctxt.getServletPackageName(); - final String targetClassName = - ((packageName.length() != 0) ? (packageName + ".") : "") - + ctxt.getServletClassName(); - final ClassLoader classLoader = ctxt.getJspLoader(); - String[] fileNames = new String[] {sourceFile}; - String[] classNames = new String[] {targetClassName}; - final ArrayList problemList = new ArrayList(); - - class CompilationUnit implements ICompilationUnit { - - String className; - String sourceFile; - - CompilationUnit(String sourceFile, String className) { - this.className = className; - this.sourceFile = sourceFile; - } - - public char[] getFileName() { - return sourceFile.toCharArray(); - } - - public char[] getContents() { - char[] result = null; - FileInputStream is = null; - try { - is = new FileInputStream(sourceFile); - Reader reader = - new BufferedReader(new InputStreamReader(is, ctxt.getOptions().getJavaEncoding())); - if (reader != null) { - char[] chars = new char[8192]; - StringBuffer buf = new StringBuffer(); - int count; - while ((count = reader.read(chars, 0, - chars.length)) > 0) { - buf.append(chars, 0, count); - } - result = new char[buf.length()]; - buf.getChars(0, result.length, result, 0); - } - } catch (IOException e) { - log.error("Compilation error", e); - } finally { - if (is != null) { - try { - is.close(); - } catch (IOException exc) { - // Ignore - } - } - } - return result; - } - - public char[] getMainTypeName() { - int dot = className.lastIndexOf('.'); - if (dot > 0) { - return className.substring(dot + 1).toCharArray(); - } - return className.toCharArray(); - } - - public char[][] getPackageName() { - StringTokenizer izer = - new StringTokenizer(className, "."); - char[][] result = new char[izer.countTokens()-1][]; - for (int i = 0; i < result.length; i++) { - String tok = izer.nextToken(); - result[i] = tok.toCharArray(); - } - return result; - } - } - - final INameEnvironment env = new INameEnvironment() { - - public NameEnvironmentAnswer - findType(char[][] compoundTypeName) { - String result = ""; - String sep = ""; - for (int i = 0; i < compoundTypeName.length; i++) { - result += sep; - result += new String(compoundTypeName[i]); - sep = "."; - } - return findType(result); - } - - public NameEnvironmentAnswer - findType(char[] typeName, - char[][] packageName) { - String result = ""; - String sep = ""; - for (int i = 0; i < packageName.length; i++) { - result += sep; - result += new String(packageName[i]); - sep = "."; - } - result += sep; - result += new String(typeName); - return findType(result); - } - - private NameEnvironmentAnswer findType(String className) { - - InputStream is = null; - try { - if (className.equals(targetClassName)) { - ICompilationUnit compilationUnit = - new CompilationUnit(sourceFile, className); - return - new NameEnvironmentAnswer(compilationUnit, null); - } - String resourceName = - className.replace('.', '/') + ".class"; - is = classLoader.getResourceAsStream(resourceName); - if (is != null) { - byte[] classBytes; - byte[] buf = new byte[8192]; - ByteArrayOutputStream baos = - new ByteArrayOutputStream(buf.length); - int count; - while ((count = is.read(buf, 0, buf.length)) > 0) { - baos.write(buf, 0, count); - } - baos.flush(); - classBytes = baos.toByteArray(); - char[] fileName = className.toCharArray(); - ClassFileReader classFileReader = - new ClassFileReader(classBytes, fileName, - true); - return - new NameEnvironmentAnswer(classFileReader, null); - } - } catch (IOException exc) { - log.error("Compilation error", exc); - } catch (org.eclipse.jdt.internal.compiler.classfmt.ClassFormatException exc) { - log.error("Compilation error", exc); - } finally { - if (is != null) { - try { - is.close(); - } catch (IOException exc) { - // Ignore - } - } - } - return null; - } - - private boolean isPackage(String result) { - if (result.equals(targetClassName)) { - return false; - } - String resourceName = result.replace('.', '/') + ".class"; - InputStream is = - classLoader.getResourceAsStream(resourceName); - return is == null; - } - - public boolean isPackage(char[][] parentPackageName, - char[] packageName) { - String result = ""; - String sep = ""; - if (parentPackageName != null) { - for (int i = 0; i < parentPackageName.length; i++) { - result += sep; - String str = new String(parentPackageName[i]); - result += str; - sep = "."; - } - } - String str = new String(packageName); - if (Character.isUpperCase(str.charAt(0))) { - if (!isPackage(result)) { - return false; - } - } - result += sep; - result += str; - return isPackage(result); - } - - public void cleanup() { - } - - }; - - final IErrorHandlingPolicy policy = - DefaultErrorHandlingPolicies.proceedWithAllProblems(); - - final Map settings = new HashMap(); - settings.put(CompilerOptions.OPTION_LineNumberAttribute, - CompilerOptions.GENERATE); - settings.put(CompilerOptions.OPTION_SourceFileAttribute, - CompilerOptions.GENERATE); - settings.put(CompilerOptions.OPTION_ReportDeprecation, - CompilerOptions.IGNORE); - if (ctxt.getOptions().getJavaEncoding() != null) { - settings.put(CompilerOptions.OPTION_Encoding, - ctxt.getOptions().getJavaEncoding()); - } - if (ctxt.getOptions().getClassDebugInfo()) { - settings.put(CompilerOptions.OPTION_LocalVariableAttribute, - CompilerOptions.GENERATE); - } - - // Source JVM - if(ctxt.getOptions().getCompilerSourceVM() != null) { - String opt = ctxt.getOptions().getCompilerSourceVM(); - if(opt.equals("1.1")) { - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_1); - } else if(opt.equals("1.2")) { - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_2); - } else if(opt.equals("1.3")) { - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_3); - } else if(opt.equals("1.4")) { - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_4); - } else if(opt.equals("1.5")) { - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_5); - } else if(opt.equals("1.6")) { - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_6); - } else if(opt.equals("1.7")) { - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_7); - } else { - log.warn("Unknown source VM " + opt + " ignored."); - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_5); - } - } else { - // Default to 1.5 - settings.put(CompilerOptions.OPTION_Source, - CompilerOptions.VERSION_1_5); - } - - // Target JVM - if(ctxt.getOptions().getCompilerTargetVM() != null) { - String opt = ctxt.getOptions().getCompilerTargetVM(); - if(opt.equals("1.1")) { - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_1); - } else if(opt.equals("1.2")) { - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_2); - } else if(opt.equals("1.3")) { - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_3); - } else if(opt.equals("1.4")) { - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_4); - } else if(opt.equals("1.5")) { - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_5); - settings.put(CompilerOptions.OPTION_Compliance, - CompilerOptions.VERSION_1_5); - } else if(opt.equals("1.6")) { - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_6); - settings.put(CompilerOptions.OPTION_Compliance, - CompilerOptions.VERSION_1_6); - } else if(opt.equals("1.7")) { - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_7); - settings.put(CompilerOptions.OPTION_Compliance, - CompilerOptions.VERSION_1_7); - } else { - log.warn("Unknown target VM " + opt + " ignored."); - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_5); - } - } else { - // Default to 1.5 - settings.put(CompilerOptions.OPTION_TargetPlatform, - CompilerOptions.VERSION_1_5); - settings.put(CompilerOptions.OPTION_Compliance, - CompilerOptions.VERSION_1_5); - } - - final IProblemFactory problemFactory = - new DefaultProblemFactory(Locale.getDefault()); - - final ICompilerRequestor requestor = new ICompilerRequestor() { - public void acceptResult(CompilationResult result) { - try { - if (result.hasProblems()) { - IProblem[] problems = result.getProblems(); - for (int i = 0; i < problems.length; i++) { - IProblem problem = problems[i]; - if (problem.isError()) { - String name = - new String(problems[i].getOriginatingFileName()); - try { - problemList.add(ErrorDispatcher.createJavacError - (name, pageNodes, new StringBuffer(problem.getMessage()), - problem.getSourceLineNumber(), ctxt)); - } catch (JasperException e) { - log.error("Error visiting node", e); - } - } - } - } - if (problemList.isEmpty()) { - ClassFile[] classFiles = result.getClassFiles(); - for (int i = 0; i < classFiles.length; i++) { - ClassFile classFile = classFiles[i]; - char[][] compoundName = - classFile.getCompoundName(); - String className = ""; - String sep = ""; - for (int j = 0; - j < compoundName.length; j++) { - className += sep; - className += new String(compoundName[j]); - sep = "."; - } - byte[] bytes = classFile.getBytes(); - String outFile = outputDir + "/" + - className.replace('.', '/') + ".class"; - FileOutputStream fout = - new FileOutputStream(outFile); - BufferedOutputStream bos = - new BufferedOutputStream(fout); - bos.write(bytes); - bos.close(); - } - } - } catch (IOException exc) { - log.error("Compilation error", exc); - } - } - }; - - ICompilationUnit[] compilationUnits = - new ICompilationUnit[classNames.length]; - for (int i = 0; i < compilationUnits.length; i++) { - String className = classNames[i]; - compilationUnits[i] = new CompilationUnit(fileNames[i], className); - } - Compiler compiler = new Compiler(env, - policy, - settings, - requestor, - problemFactory, - true); - compiler.compile(compilationUnits); - - if (!ctxt.keepGenerated()) { - File javaFile = new File(ctxt.getServletJavaFileName()); - javaFile.delete(); - } - - if (!problemList.isEmpty()) { - JavacErrorDetail[] jeds = - (JavacErrorDetail[]) problemList.toArray(new JavacErrorDetail[0]); - errDispatcher.javacError(jeds); - } - - if( log.isDebugEnabled() ) { - long t2=System.currentTimeMillis(); - log.debug("Compiled " + ctxt.getServletJavaFileName() + " " - + (t2-t1) + "ms"); - } - - if (ctxt.isPrototypeMode()) { - return; - } - - // JSR45 Support - if (! options.isSmapSuppressed()) { - SmapUtil.installSmap(smap); - } - - } - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JasperTagInfo.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JasperTagInfo.java deleted file mode 100644 index 8586d5e60..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JasperTagInfo.java +++ /dev/null @@ -1,58 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import javax.servlet.jsp.tagext.*; - -/** - * TagInfo extension used by tag handlers that are implemented via tag files. - * This class provides access to the name of the Map used to store the - * dynamic attribute names and values passed to the custom action invocation. - * This information is used by the code generator. - */ -class JasperTagInfo extends TagInfo { - - private String dynamicAttrsMapName; - - public JasperTagInfo(String tagName, - String tagClassName, - String bodyContent, - String infoString, - TagLibraryInfo taglib, - TagExtraInfo tagExtraInfo, - TagAttributeInfo[] attributeInfo, - String displayName, - String smallIcon, - String largeIcon, - TagVariableInfo[] tvi, - String mapName) { - - super(tagName, tagClassName, bodyContent, infoString, taglib, - tagExtraInfo, attributeInfo, displayName, smallIcon, largeIcon, - tvi); - this.dynamicAttrsMapName = mapName; - } - - public String getDynamicAttributesMapName() { - return dynamicAttrsMapName; - } - - public boolean hasDynamicAttributes() { - return dynamicAttrsMapName != null; - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JavacErrorDetail.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JavacErrorDetail.java deleted file mode 100644 index cf2daffe1..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JavacErrorDetail.java +++ /dev/null @@ -1,232 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.BufferedReader; -import java.io.FileInputStream; -import java.io.IOException; -import java.io.InputStream; -import java.io.InputStreamReader; -import java.util.ArrayList; -import java.util.List; - -import org.apache.jasper.JspCompilationContext; - -/** - * Class providing details about a javac compilation error. - * - * @author Jan Luehe - * @author Kin-man Chung - */ -public class JavacErrorDetail { - - private String javaFileName; - private int javaLineNum; - private String jspFileName; - private int jspBeginLineNum; - private StringBuffer errMsg; - private String jspExtract = null; - - /** - * Constructor. - * - * @param javaFileName The name of the Java file in which the - * compilation error occurred - * @param javaLineNum The compilation error line number - * @param errMsg The compilation error message - */ - public JavacErrorDetail(String javaFileName, - int javaLineNum, - StringBuffer errMsg) { - - this.javaFileName = javaFileName; - this.javaLineNum = javaLineNum; - this.errMsg = errMsg; - this.jspBeginLineNum = -1; - } - - /** - * Constructor. - * - * @param javaFileName The name of the Java file in which the - * compilation error occurred - * @param javaLineNum The compilation error line number - * @param jspFileName The name of the JSP file from which the Java source - * file was generated - * @param jspBeginLineNum The start line number of the JSP element - * responsible for the compilation error - * @param errMsg The compilation error message - */ - public JavacErrorDetail(String javaFileName, - int javaLineNum, - String jspFileName, - int jspBeginLineNum, - StringBuffer errMsg) { - - this(javaFileName, javaLineNum, jspFileName, jspBeginLineNum, errMsg, - null); - } - - public JavacErrorDetail(String javaFileName, - int javaLineNum, - String jspFileName, - int jspBeginLineNum, - StringBuffer errMsg, - JspCompilationContext ctxt) { - - this(javaFileName, javaLineNum, errMsg); - this.jspFileName = jspFileName; - this.jspBeginLineNum = jspBeginLineNum; - - if (jspBeginLineNum > 0 && ctxt != null) { - InputStream is = null; - FileInputStream fis = null; - - try { - // Read both files in, so we can inspect them - is = ctxt.getResourceAsStream(jspFileName); - String[] jspLines = readFile(is); - - fis = new FileInputStream(ctxt.getServletJavaFileName()); - String[] javaLines = readFile(fis); - - // If the line contains the opening of a multi-line scriptlet - // block, then the JSP line number we got back is probably - // faulty. Scan forward to match the java line... - if (jspLines[jspBeginLineNum-1].lastIndexOf("<%") > - jspLines[jspBeginLineNum-1].lastIndexOf("%>")) { - String javaLine = javaLines[javaLineNum-1].trim(); - - for (int i=jspBeginLineNum-1; i= 0) { - path = urlPattern.substring(0,i+1); - file = urlPattern.substring(i+1); - } else { - file = urlPattern; - } - - // pattern must be "*", or of the form "*.jsp" - if (file.equals("*")) { - extension = "*"; - } else if (file.startsWith("*.")) { - extension = file.substring(file.indexOf('.')+1); - } - - // The url patterns are reconstructed as the follwoing: - // path != null, extension == null: / or /foo/bar.ext - // path == null, extension != null: *.ext - // path != null, extension == "*": /foo/* - boolean isStar = "*".equals(extension); - if ((path == null && (extension == null || isStar)) - || (path != null && !isStar)) { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.bad.urlpattern.propertygroup", - urlPattern)); - } - continue; - } - } - - JspProperty property = new JspProperty(isXml, - elIgnored, - scriptingInvalid, - pageEncoding, - includePrelude, - includeCoda, - deferredSyntaxAllowedAsLiteral, - trimDirectiveWhitespaces); - JspPropertyGroup propertyGroup = - new JspPropertyGroup(path, extension, property); - - jspProperties.addElement(propertyGroup); - } - } - } catch (Exception ex) { - throw new JasperException(ex); - } finally { - if (is != null) { - try { - is.close(); - } catch (Throwable t) {} - } - } - } - - private void init() throws JasperException { - - if (!initialized) { - processWebDotXml(ctxt); - defaultJspProperty = new JspProperty(defaultIsXml, - defaultIsELIgnored, - defaultIsScriptingInvalid, - null, null, null, defaultDeferedSyntaxAllowedAsLiteral, - defaultTrimDirectiveWhitespaces); - initialized = true; - } - } - - /** - * Select the property group that has more restrictive url-pattern. - * In case of tie, select the first. - */ - private JspPropertyGroup selectProperty(JspPropertyGroup prev, - JspPropertyGroup curr) { - if (prev == null) { - return curr; - } - if (prev.getExtension() == null) { - // exact match - return prev; - } - if (curr.getExtension() == null) { - // exact match - return curr; - } - String prevPath = prev.getPath(); - String currPath = curr.getPath(); - if (prevPath == null && currPath == null) { - // Both specifies a *.ext, keep the first one - return prev; - } - if (prevPath == null && currPath != null) { - return curr; - } - if (prevPath != null && currPath == null) { - return prev; - } - if (prevPath.length() >= currPath.length()) { - return prev; - } - return curr; - } - - - /** - * Find a property that best matches the supplied resource. - * @param uri the resource supplied. - * @return a JspProperty indicating the best match, or some default. - */ - public JspProperty findJspProperty(String uri) throws JasperException { - - init(); - - // JSP Configuration settings do not apply to tag files - if (jspProperties == null || uri.endsWith(".tag") - || uri.endsWith(".tagx")) { - return defaultJspProperty; - } - - String uriPath = null; - int index = uri.lastIndexOf('/'); - if (index >=0 ) { - uriPath = uri.substring(0, index+1); - } - String uriExtension = null; - index = uri.lastIndexOf('.'); - if (index >=0) { - uriExtension = uri.substring(index+1); - } - - Vector includePreludes = new Vector(); - Vector includeCodas = new Vector(); - - JspPropertyGroup isXmlMatch = null; - JspPropertyGroup elIgnoredMatch = null; - JspPropertyGroup scriptingInvalidMatch = null; - JspPropertyGroup pageEncodingMatch = null; - JspPropertyGroup deferedSyntaxAllowedAsLiteralMatch = null; - JspPropertyGroup trimDirectiveWhitespacesMatch = null; - - Iterator iter = jspProperties.iterator(); - while (iter.hasNext()) { - - JspPropertyGroup jpg = (JspPropertyGroup) iter.next(); - JspProperty jp = jpg.getJspProperty(); - - // (arrays will be the same length) - String extension = jpg.getExtension(); - String path = jpg.getPath(); - - if (extension == null) { - // exact match pattern: /a/foo.jsp - if (!uri.equals(path)) { - // not matched; - continue; - } - } else { - // Matching patterns *.ext or /p/* - if (path != null && uriPath != null && - ! uriPath.startsWith(path)) { - // not matched - continue; - } - if (!extension.equals("*") && - !extension.equals(uriExtension)) { - // not matched - continue; - } - } - // We have a match - // Add include-preludes and include-codas - if (jp.getIncludePrelude() != null) { - includePreludes.addAll(jp.getIncludePrelude()); - } - if (jp.getIncludeCoda() != null) { - includeCodas.addAll(jp.getIncludeCoda()); - } - - // If there is a previous match for the same property, remember - // the one that is more restrictive. - if (jp.isXml() != null) { - isXmlMatch = selectProperty(isXmlMatch, jpg); - } - if (jp.isELIgnored() != null) { - elIgnoredMatch = selectProperty(elIgnoredMatch, jpg); - } - if (jp.isScriptingInvalid() != null) { - scriptingInvalidMatch = - selectProperty(scriptingInvalidMatch, jpg); - } - if (jp.getPageEncoding() != null) { - pageEncodingMatch = selectProperty(pageEncodingMatch, jpg); - } - if (jp.isDeferedSyntaxAllowedAsLiteral() != null) { - deferedSyntaxAllowedAsLiteralMatch = - selectProperty(deferedSyntaxAllowedAsLiteralMatch, jpg); - } - if (jp.isTrimDirectiveWhitespaces() != null) { - trimDirectiveWhitespacesMatch = - selectProperty(trimDirectiveWhitespacesMatch, jpg); - } - } - - - String isXml = defaultIsXml; - String isELIgnored = defaultIsELIgnored; - String isScriptingInvalid = defaultIsScriptingInvalid; - String pageEncoding = null; - String isDeferedSyntaxAllowedAsLiteral = defaultDeferedSyntaxAllowedAsLiteral; - String isTrimDirectiveWhitespaces = defaultTrimDirectiveWhitespaces; - - if (isXmlMatch != null) { - isXml = isXmlMatch.getJspProperty().isXml(); - } - if (elIgnoredMatch != null) { - isELIgnored = elIgnoredMatch.getJspProperty().isELIgnored(); - } - if (scriptingInvalidMatch != null) { - isScriptingInvalid = - scriptingInvalidMatch.getJspProperty().isScriptingInvalid(); - } - if (pageEncodingMatch != null) { - pageEncoding = pageEncodingMatch.getJspProperty().getPageEncoding(); - } - if (deferedSyntaxAllowedAsLiteralMatch != null) { - isDeferedSyntaxAllowedAsLiteral = - deferedSyntaxAllowedAsLiteralMatch.getJspProperty().isDeferedSyntaxAllowedAsLiteral(); - } - if (trimDirectiveWhitespacesMatch != null) { - isTrimDirectiveWhitespaces = - trimDirectiveWhitespacesMatch.getJspProperty().isTrimDirectiveWhitespaces(); - } - - return new JspProperty(isXml, isELIgnored, isScriptingInvalid, - pageEncoding, includePreludes, includeCodas, - isDeferedSyntaxAllowedAsLiteral, isTrimDirectiveWhitespaces); - } - - /** - * To find out if an uri matches an url pattern in jsp config. If so, - * then the uri is a JSP page. This is used primarily for jspc. - */ - public boolean isJspPage(String uri) throws JasperException { - - init(); - if (jspProperties == null) { - return false; - } - - String uriPath = null; - int index = uri.lastIndexOf('/'); - if (index >=0 ) { - uriPath = uri.substring(0, index+1); - } - String uriExtension = null; - index = uri.lastIndexOf('.'); - if (index >=0) { - uriExtension = uri.substring(index+1); - } - - Iterator iter = jspProperties.iterator(); - while (iter.hasNext()) { - - JspPropertyGroup jpg = (JspPropertyGroup) iter.next(); - JspProperty jp = jpg.getJspProperty(); - - String extension = jpg.getExtension(); - String path = jpg.getPath(); - - if (extension == null) { - if (uri.equals(path)) { - // There is an exact match - return true; - } - } else { - if ((path == null || path.equals(uriPath)) && - (extension.equals("*") || extension.equals(uriExtension))) { - // Matches *, *.ext, /p/*, or /p/*.ext - return true; - } - } - } - return false; - } - - static class JspPropertyGroup { - private String path; - private String extension; - private JspProperty jspProperty; - - JspPropertyGroup(String path, String extension, - JspProperty jspProperty) { - this.path = path; - this.extension = extension; - this.jspProperty = jspProperty; - } - - public String getPath() { - return path; - } - - public String getExtension() { - return extension; - } - - public JspProperty getJspProperty() { - return jspProperty; - } - } - - static public class JspProperty { - - private String isXml; - private String elIgnored; - private String scriptingInvalid; - private String pageEncoding; - private Vector includePrelude; - private Vector includeCoda; - private String deferedSyntaxAllowedAsLiteral; - private String trimDirectiveWhitespaces; - - public JspProperty(String isXml, String elIgnored, - String scriptingInvalid, String pageEncoding, - Vector includePrelude, Vector includeCoda, - String deferedSyntaxAllowedAsLiteral, - String trimDirectiveWhitespaces) { - - this.isXml = isXml; - this.elIgnored = elIgnored; - this.scriptingInvalid = scriptingInvalid; - this.pageEncoding = pageEncoding; - this.includePrelude = includePrelude; - this.includeCoda = includeCoda; - this.deferedSyntaxAllowedAsLiteral = deferedSyntaxAllowedAsLiteral; - this.trimDirectiveWhitespaces = trimDirectiveWhitespaces; - } - - public String isXml() { - return isXml; - } - - public String isELIgnored() { - return elIgnored; - } - - public String isScriptingInvalid() { - return scriptingInvalid; - } - - public String getPageEncoding() { - return pageEncoding; - } - - public Vector getIncludePrelude() { - return includePrelude; - } - - public Vector getIncludeCoda() { - return includeCoda; - } - - public String isDeferedSyntaxAllowedAsLiteral() { - return deferedSyntaxAllowedAsLiteral; - } - - public String isTrimDirectiveWhitespaces() { - return trimDirectiveWhitespaces; - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspDocumentParser.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspDocumentParser.java deleted file mode 100644 index 3acd9d5b9..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspDocumentParser.java +++ /dev/null @@ -1,1453 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import java.io.CharArrayWriter; -import java.io.FileNotFoundException; -import java.io.IOException; -import java.io.InputStream; - -import java.util.Iterator; -import java.util.List; -import java.util.jar.JarFile; - -import javax.servlet.jsp.tagext.TagFileInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagLibraryInfo; -import javax.xml.parsers.SAXParser; -import javax.xml.parsers.SAXParserFactory; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.xml.sax.Attributes; -import org.xml.sax.InputSource; -import org.xml.sax.Locator; -import org.xml.sax.SAXException; -import org.xml.sax.SAXParseException; -import org.xml.sax.XMLReader; -import org.xml.sax.ext.LexicalHandler; -import org.xml.sax.helpers.AttributesImpl; -import org.xml.sax.helpers.DefaultHandler; - -/** - * Class implementing a parser for a JSP document, that is, a JSP page in XML - * syntax. - * - * @author Jan Luehe - * @author Kin-man Chung - */ - -class JspDocumentParser - extends DefaultHandler - implements LexicalHandler, TagConstants { - - private static final String JSP_VERSION = "version"; - private static final String LEXICAL_HANDLER_PROPERTY = - "http://xml.org/sax/properties/lexical-handler"; - private static final String JSP_URI = "http://java.sun.com/JSP/Page"; - - private static final EnableDTDValidationException ENABLE_DTD_VALIDATION_EXCEPTION = - new EnableDTDValidationException( - "jsp.error.enable_dtd_validation", - null); - - private ParserController parserController; - private JspCompilationContext ctxt; - private PageInfo pageInfo; - private String path; - private StringBuffer charBuffer; - - // Node representing the XML element currently being parsed - private Node current; - - /* - * Outermost (in the nesting hierarchy) node whose body is declared to be - * scriptless. If a node's body is declared to be scriptless, all its - * nested nodes must be scriptless, too. - */ - private Node scriptlessBodyNode; - - private Locator locator; - - //Mark representing the start of the current element. Note - //that locator.getLineNumber() and locator.getColumnNumber() - //return the line and column numbers for the character - //immediately _following_ the current element. The underlying - //XMl parser eats white space that is not part of character - //data, so for Nodes that are not created from character data, - //this is the best we can do. But when we parse character data, - //we get an accurate starting location by starting with startMark - //as set by the previous element, and updating it as we advance - //through the characters. - private Mark startMark; - - // Flag indicating whether we are inside DTD declarations - private boolean inDTD; - - private boolean isValidating; - - private ErrorDispatcher err; - private boolean isTagFile; - private boolean directivesOnly; - private boolean isTop; - - // Nesting level of Tag dependent bodies - private int tagDependentNesting = 0; - // Flag set to delay incrmenting tagDependentNesting until jsp:body - // is first encountered - private boolean tagDependentPending = false; - - /* - * Constructor - */ - public JspDocumentParser( - ParserController pc, - String path, - boolean isTagFile, - boolean directivesOnly) { - this.parserController = pc; - this.ctxt = pc.getJspCompilationContext(); - this.pageInfo = pc.getCompiler().getPageInfo(); - this.err = pc.getCompiler().getErrorDispatcher(); - this.path = path; - this.isTagFile = isTagFile; - this.directivesOnly = directivesOnly; - this.isTop = true; - } - - /* - * Parses a JSP document by responding to SAX events. - * - * @throws JasperException - */ - public static Node.Nodes parse( - ParserController pc, - String path, - JarFile jarFile, - Node parent, - boolean isTagFile, - boolean directivesOnly, - String pageEnc, - String jspConfigPageEnc, - boolean isEncodingSpecifiedInProlog, - boolean isBomPresent) - throws JasperException { - - JspDocumentParser jspDocParser = - new JspDocumentParser(pc, path, isTagFile, directivesOnly); - Node.Nodes pageNodes = null; - - try { - - // Create dummy root and initialize it with given page encodings - Node.Root dummyRoot = new Node.Root(null, parent, true); - dummyRoot.setPageEncoding(pageEnc); - dummyRoot.setJspConfigPageEncoding(jspConfigPageEnc); - dummyRoot.setIsEncodingSpecifiedInProlog( - isEncodingSpecifiedInProlog); - dummyRoot.setIsBomPresent(isBomPresent); - jspDocParser.current = dummyRoot; - if (parent == null) { - jspDocParser.addInclude( - dummyRoot, - jspDocParser.pageInfo.getIncludePrelude()); - } else { - jspDocParser.isTop = false; - } - - // Parse the input - SAXParser saxParser = getSAXParser(false, jspDocParser); - InputStream inStream = null; - try { - inStream = JspUtil.getInputStream(path, jarFile, - jspDocParser.ctxt, - jspDocParser.err); - saxParser.parse(new InputSource(inStream), jspDocParser); - } catch (EnableDTDValidationException e) { - saxParser = getSAXParser(true, jspDocParser); - jspDocParser.isValidating = true; - if (inStream != null) { - try { - inStream.close(); - } catch (Exception any) { - } - } - inStream = JspUtil.getInputStream(path, jarFile, - jspDocParser.ctxt, - jspDocParser.err); - saxParser.parse(new InputSource(inStream), jspDocParser); - } finally { - if (inStream != null) { - try { - inStream.close(); - } catch (Exception any) { - } - } - } - - if (parent == null) { - jspDocParser.addInclude( - dummyRoot, - jspDocParser.pageInfo.getIncludeCoda()); - } - - // Create Node.Nodes from dummy root - pageNodes = new Node.Nodes(dummyRoot); - - } catch (IOException ioe) { - jspDocParser.err.jspError("jsp.error.data.file.read", path, ioe); - } catch (SAXParseException e) { - jspDocParser.err.jspError - (new Mark(jspDocParser.ctxt, path, e.getLineNumber(), - e.getColumnNumber()), - e.getMessage()); - } catch (Exception e) { - jspDocParser.err.jspError(e); - } - - return pageNodes; - } - - /* - * Processes the given list of included files. - * - * This is used to implement the include-prelude and include-coda - * subelements of the jsp-config element in web.xml - */ - private void addInclude(Node parent, List files) throws SAXException { - if (files != null) { - Iterator iter = files.iterator(); - while (iter.hasNext()) { - String file = (String)iter.next(); - AttributesImpl attrs = new AttributesImpl(); - attrs.addAttribute("", "file", "file", "CDATA", file); - - // Create a dummy Include directive node - Node includeDir = - new Node.IncludeDirective(attrs, null, // XXX - parent); - processIncludeDirective(file, includeDir); - } - } - } - - /* - * Receives notification of the start of an element. - * - * This method assigns the given tag attributes to one of 3 buckets: - * - * - "xmlns" attributes that represent (standard or custom) tag libraries. - * - "xmlns" attributes that do not represent tag libraries. - * - all remaining attributes. - * - * For each "xmlns" attribute that represents a custom tag library, the - * corresponding TagLibraryInfo object is added to the set of custom - * tag libraries. - */ - public void startElement( - String uri, - String localName, - String qName, - Attributes attrs) - throws SAXException { - - AttributesImpl taglibAttrs = null; - AttributesImpl nonTaglibAttrs = null; - AttributesImpl nonTaglibXmlnsAttrs = null; - - processChars(); - - checkPrefixes(uri, qName, attrs); - - if (directivesOnly && - !(JSP_URI.equals(uri) && localName.startsWith(DIRECTIVE_ACTION))) { - return; - } - - String currentPrefix = getPrefix(current.getQName()); - - // jsp:text must not have any subelements - if (JSP_URI.equals(uri) && TEXT_ACTION.equals(current.getLocalName()) - && "jsp".equals(currentPrefix)) { - throw new SAXParseException( - Localizer.getMessage("jsp.error.text.has_subelement"), - locator); - } - - startMark = new Mark(ctxt, path, locator.getLineNumber(), - locator.getColumnNumber()); - - if (attrs != null) { - /* - * Notice that due to a bug in the underlying SAX parser, the - * attributes must be enumerated in descending order. - */ - boolean isTaglib = false; - for (int i = attrs.getLength() - 1; i >= 0; i--) { - isTaglib = false; - String attrQName = attrs.getQName(i); - if (!attrQName.startsWith("xmlns")) { - if (nonTaglibAttrs == null) { - nonTaglibAttrs = new AttributesImpl(); - } - nonTaglibAttrs.addAttribute( - attrs.getURI(i), - attrs.getLocalName(i), - attrs.getQName(i), - attrs.getType(i), - attrs.getValue(i)); - } else { - if (attrQName.startsWith("xmlns:jsp")) { - isTaglib = true; - } else { - String attrUri = attrs.getValue(i); - // TaglibInfo for this uri already established in - // startPrefixMapping - isTaglib = pageInfo.hasTaglib(attrUri); - } - if (isTaglib) { - if (taglibAttrs == null) { - taglibAttrs = new AttributesImpl(); - } - taglibAttrs.addAttribute( - attrs.getURI(i), - attrs.getLocalName(i), - attrs.getQName(i), - attrs.getType(i), - attrs.getValue(i)); - } else { - if (nonTaglibXmlnsAttrs == null) { - nonTaglibXmlnsAttrs = new AttributesImpl(); - } - nonTaglibXmlnsAttrs.addAttribute( - attrs.getURI(i), - attrs.getLocalName(i), - attrs.getQName(i), - attrs.getType(i), - attrs.getValue(i)); - } - } - } - } - - Node node = null; - - if (tagDependentPending && JSP_URI.equals(uri) && - localName.equals(BODY_ACTION)) { - tagDependentPending = false; - tagDependentNesting++; - current = - parseStandardAction( - qName, - localName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - startMark, - current); - return; - } - - if (tagDependentPending && JSP_URI.equals(uri) && - localName.equals(ATTRIBUTE_ACTION)) { - current = - parseStandardAction( - qName, - localName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - startMark, - current); - return; - } - - if (tagDependentPending) { - tagDependentPending = false; - tagDependentNesting++; - } - - if (tagDependentNesting > 0) { - node = - new Node.UninterpretedTag( - qName, - localName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - startMark, - current); - } else if (JSP_URI.equals(uri)) { - node = - parseStandardAction( - qName, - localName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - startMark, - current); - } else { - node = - parseCustomAction( - qName, - localName, - uri, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - startMark, - current); - if (node == null) { - node = - new Node.UninterpretedTag( - qName, - localName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - startMark, - current); - } else { - // custom action - String bodyType = getBodyType((Node.CustomTag) node); - - if (scriptlessBodyNode == null - && bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_SCRIPTLESS)) { - scriptlessBodyNode = node; - } - else if (TagInfo.BODY_CONTENT_TAG_DEPENDENT.equalsIgnoreCase(bodyType)) { - tagDependentPending = true; - } - } - } - - current = node; - } - - /* - * Receives notification of character data inside an element. - * - * The SAX does not call this method with all of the template text, but may - * invoke this method with chunks of it. This is a problem when we try - * to determine if the text contains only whitespaces, or when we are - * looking for an EL expression string. Therefore it is necessary to - * buffer and concatenate the chunks and process the concatenated text - * later (at beginTag and endTag) - * - * @param buf The characters - * @param offset The start position in the character array - * @param len The number of characters to use from the character array - * - * @throws SAXException - */ - public void characters(char[] buf, int offset, int len) { - - if (charBuffer == null) { - charBuffer = new StringBuffer(); - } - charBuffer.append(buf, offset, len); - } - - private void processChars() throws SAXException { - - if (charBuffer == null || directivesOnly) { - return; - } - - /* - * JSP.6.1.1: All textual nodes that have only white space are to be - * dropped from the document, except for nodes in a jsp:text element, - * and any leading and trailing white-space-only textual nodes in a - * jsp:attribute whose 'trim' attribute is set to FALSE, which are to - * be kept verbatim. - * JSP.6.2.3 defines white space characters. - */ - boolean isAllSpace = true; - if (!(current instanceof Node.JspText) - && !(current instanceof Node.NamedAttribute)) { - for (int i = 0; i < charBuffer.length(); i++) { - if (!(charBuffer.charAt(i) == ' ' - || charBuffer.charAt(i) == '\n' - || charBuffer.charAt(i) == '\r' - || charBuffer.charAt(i) == '\t')) { - isAllSpace = false; - break; - } - } - } - - if (!isAllSpace && tagDependentPending) { - tagDependentPending = false; - tagDependentNesting++; - } - - if (tagDependentNesting > 0) { - if (charBuffer.length() > 0) { - new Node.TemplateText(charBuffer.toString(), startMark, current); - } - startMark = new Mark(ctxt, path, locator.getLineNumber(), - locator.getColumnNumber()); - charBuffer = null; - return; - } - - if ((current instanceof Node.JspText) - || (current instanceof Node.NamedAttribute) - || !isAllSpace) { - - int line = startMark.getLineNumber(); - int column = startMark.getColumnNumber(); - - CharArrayWriter ttext = new CharArrayWriter(); - int lastCh = 0, elType = 0; - for (int i = 0; i < charBuffer.length(); i++) { - - int ch = charBuffer.charAt(i); - if (ch == '\n') { - column = 1; - line++; - } else { - column++; - } - if ((lastCh == '$' || lastCh == '#') && ch == '{') { - elType = lastCh; - if (ttext.size() > 0) { - new Node.TemplateText( - ttext.toString(), - startMark, - current); - ttext = new CharArrayWriter(); - //We subtract two from the column number to - //account for the '[$,#]{' that we've already parsed - startMark = new Mark(ctxt, path, line, column - 2); - } - // following "${" || "#{" to first unquoted "}" - i++; - boolean singleQ = false; - boolean doubleQ = false; - lastCh = 0; - for (;; i++) { - if (i >= charBuffer.length()) { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.unterminated", - (char) elType + "{"), - locator); - - } - ch = charBuffer.charAt(i); - if (ch == '\n') { - column = 1; - line++; - } else { - column++; - } - if (lastCh == '\\' && (singleQ || doubleQ)) { - ttext.write(ch); - lastCh = 0; - continue; - } - if (ch == '}') { - new Node.ELExpression((char) elType, - ttext.toString(), - startMark, - current); - ttext = new CharArrayWriter(); - startMark = new Mark(ctxt, path, line, column); - break; - } - if (ch == '"') - doubleQ = !doubleQ; - else if (ch == '\'') - singleQ = !singleQ; - - ttext.write(ch); - lastCh = ch; - } - } else if (lastCh == '\\' && (ch == '$' || ch == '#')) { - if (pageInfo.isELIgnored()) { - ttext.write('\\'); - } - ttext.write(ch); - ch = 0; // Not start of EL anymore - } else { - if (lastCh == '$' || lastCh == '#' || lastCh == '\\') { - ttext.write(lastCh); - } - if (ch != '$' && ch != '#' && ch != '\\') { - ttext.write(ch); - } - } - lastCh = ch; - } - if (lastCh == '$' || lastCh == '#' || lastCh == '\\') { - ttext.write(lastCh); - } - if (ttext.size() > 0) { - new Node.TemplateText(ttext.toString(), startMark, current); - } - } - startMark = new Mark(ctxt, path, locator.getLineNumber(), - locator.getColumnNumber()); - - charBuffer = null; - } - - /* - * Receives notification of the end of an element. - */ - public void endElement(String uri, String localName, String qName) - throws SAXException { - - processChars(); - - if (directivesOnly && - !(JSP_URI.equals(uri) && localName.startsWith(DIRECTIVE_ACTION))) { - return; - } - - if (current instanceof Node.NamedAttribute) { - boolean isTrim = ((Node.NamedAttribute)current).isTrim(); - Node.Nodes subElems = ((Node.NamedAttribute)current).getBody(); - for (int i = 0; subElems != null && i < subElems.size(); i++) { - Node subElem = subElems.getNode(i); - if (!(subElem instanceof Node.TemplateText)) { - continue; - } - // Ignore any whitespace (including spaces, carriage returns, - // line feeds, and tabs, that appear at the beginning and at - // the end of the body of the action, if the - // action's 'trim' attribute is set to TRUE (default). - // In addition, any textual nodes in the that - // have only white space are dropped from the document, with - // the exception of leading and trailing white-space-only - // textual nodes in a whose 'trim' attribute - // is set to FALSE, which must be kept verbatim. - if (i == 0) { - if (isTrim) { - ((Node.TemplateText)subElem).ltrim(); - } - } else if (i == subElems.size() - 1) { - if (isTrim) { - ((Node.TemplateText)subElem).rtrim(); - } - } else { - if (((Node.TemplateText)subElem).isAllSpace()) { - subElems.remove(subElem); - } - } - } - } else if (current instanceof Node.ScriptingElement) { - checkScriptingBody((Node.ScriptingElement)current); - } - - if ( isTagDependent(current)) { - tagDependentNesting--; - } - - if (scriptlessBodyNode != null - && current.equals(scriptlessBodyNode)) { - scriptlessBodyNode = null; - } - - if (current.getParent() != null) { - current = current.getParent(); - } - } - - /* - * Receives the document locator. - * - * @param locator the document locator - */ - public void setDocumentLocator(Locator locator) { - this.locator = locator; - } - - /* - * See org.xml.sax.ext.LexicalHandler. - */ - public void comment(char[] buf, int offset, int len) throws SAXException { - - processChars(); // Flush char buffer and remove white spaces - - // ignore comments in the DTD - if (!inDTD) { - startMark = - new Mark( - ctxt, - path, - locator.getLineNumber(), - locator.getColumnNumber()); - new Node.Comment(new String(buf, offset, len), startMark, current); - } - } - - /* - * See org.xml.sax.ext.LexicalHandler. - */ - public void startCDATA() throws SAXException { - - processChars(); // Flush char buffer and remove white spaces - startMark = new Mark(ctxt, path, locator.getLineNumber(), - locator.getColumnNumber()); - } - - /* - * See org.xml.sax.ext.LexicalHandler. - */ - public void endCDATA() throws SAXException { - processChars(); // Flush char buffer and remove white spaces - } - - /* - * See org.xml.sax.ext.LexicalHandler. - */ - public void startEntity(String name) throws SAXException { - // do nothing - } - - /* - * See org.xml.sax.ext.LexicalHandler. - */ - public void endEntity(String name) throws SAXException { - // do nothing - } - - /* - * See org.xml.sax.ext.LexicalHandler. - */ - public void startDTD(String name, String publicId, String systemId) - throws SAXException { - if (!isValidating) { - fatalError(ENABLE_DTD_VALIDATION_EXCEPTION); - } - - inDTD = true; - } - - /* - * See org.xml.sax.ext.LexicalHandler. - */ - public void endDTD() throws SAXException { - inDTD = false; - } - - /* - * Receives notification of a non-recoverable error. - */ - public void fatalError(SAXParseException e) throws SAXException { - throw e; - } - - /* - * Receives notification of a recoverable error. - */ - public void error(SAXParseException e) throws SAXException { - throw e; - } - - /* - * Receives notification of the start of a Namespace mapping. - */ - public void startPrefixMapping(String prefix, String uri) - throws SAXException { - TagLibraryInfo taglibInfo; - - if (directivesOnly && !(JSP_URI.equals(uri))) { - return; - } - - try { - taglibInfo = getTaglibInfo(prefix, uri); - } catch (JasperException je) { - throw new SAXParseException( - Localizer.getMessage("jsp.error.could.not.add.taglibraries"), - locator, - je); - } - - if (taglibInfo != null) { - if (pageInfo.getTaglib(uri) == null) { - pageInfo.addTaglib(uri, taglibInfo); - } - pageInfo.pushPrefixMapping(prefix, uri); - } else { - pageInfo.pushPrefixMapping(prefix, null); - } - } - - /* - * Receives notification of the end of a Namespace mapping. - */ - public void endPrefixMapping(String prefix) throws SAXException { - - if (directivesOnly) { - String uri = pageInfo.getURI(prefix); - if (!JSP_URI.equals(uri)) { - return; - } - } - - pageInfo.popPrefixMapping(prefix); - } - - //********************************************************************* - // Private utility methods - - private Node parseStandardAction( - String qName, - String localName, - Attributes nonTaglibAttrs, - Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, - Mark start, - Node parent) - throws SAXException { - - Node node = null; - - if (localName.equals(ROOT_ACTION)) { - if (!(current instanceof Node.Root)) { - throw new SAXParseException( - Localizer.getMessage("jsp.error.nested_jsproot"), - locator); - } - node = - new Node.JspRoot( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - if (isTop) { - pageInfo.setHasJspRoot(true); - } - } else if (localName.equals(PAGE_DIRECTIVE_ACTION)) { - if (isTagFile) { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.action.istagfile", - localName), - locator); - } - node = - new Node.PageDirective( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - String imports = nonTaglibAttrs.getValue("import"); - // There can only be one 'import' attribute per page directive - if (imports != null) { - ((Node.PageDirective)node).addImport(imports); - } - } else if (localName.equals(INCLUDE_DIRECTIVE_ACTION)) { - node = - new Node.IncludeDirective( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - processIncludeDirective(nonTaglibAttrs.getValue("file"), node); - } else if (localName.equals(DECLARATION_ACTION)) { - if (scriptlessBodyNode != null) { - // We're nested inside a node whose body is - // declared to be scriptless - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.no.scriptlets", - localName), - locator); - } - node = - new Node.Declaration( - qName, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(SCRIPTLET_ACTION)) { - if (scriptlessBodyNode != null) { - // We're nested inside a node whose body is - // declared to be scriptless - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.no.scriptlets", - localName), - locator); - } - node = - new Node.Scriptlet( - qName, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(EXPRESSION_ACTION)) { - if (scriptlessBodyNode != null) { - // We're nested inside a node whose body is - // declared to be scriptless - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.no.scriptlets", - localName), - locator); - } - node = - new Node.Expression( - qName, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(USE_BEAN_ACTION)) { - node = - new Node.UseBean( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(SET_PROPERTY_ACTION)) { - node = - new Node.SetProperty( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(GET_PROPERTY_ACTION)) { - node = - new Node.GetProperty( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(INCLUDE_ACTION)) { - node = - new Node.IncludeAction( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(FORWARD_ACTION)) { - node = - new Node.ForwardAction( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(PARAM_ACTION)) { - node = - new Node.ParamAction( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(PARAMS_ACTION)) { - node = - new Node.ParamsAction( - qName, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(PLUGIN_ACTION)) { - node = - new Node.PlugIn( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(TEXT_ACTION)) { - node = - new Node.JspText( - qName, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(BODY_ACTION)) { - node = - new Node.JspBody( - qName, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(ATTRIBUTE_ACTION)) { - node = - new Node.NamedAttribute( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(OUTPUT_ACTION)) { - node = - new Node.JspOutput( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(TAG_DIRECTIVE_ACTION)) { - if (!isTagFile) { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.action.isnottagfile", - localName), - locator); - } - node = - new Node.TagDirective( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - String imports = nonTaglibAttrs.getValue("import"); - // There can only be one 'import' attribute per tag directive - if (imports != null) { - ((Node.TagDirective)node).addImport(imports); - } - } else if (localName.equals(ATTRIBUTE_DIRECTIVE_ACTION)) { - if (!isTagFile) { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.action.isnottagfile", - localName), - locator); - } - node = - new Node.AttributeDirective( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(VARIABLE_DIRECTIVE_ACTION)) { - if (!isTagFile) { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.action.isnottagfile", - localName), - locator); - } - node = - new Node.VariableDirective( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(INVOKE_ACTION)) { - if (!isTagFile) { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.action.isnottagfile", - localName), - locator); - } - node = - new Node.InvokeAction( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(DOBODY_ACTION)) { - if (!isTagFile) { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.action.isnottagfile", - localName), - locator); - } - node = - new Node.DoBodyAction( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(ELEMENT_ACTION)) { - node = - new Node.JspElement( - qName, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else if (localName.equals(FALLBACK_ACTION)) { - node = - new Node.FallBackAction( - qName, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - current); - } else { - throw new SAXParseException( - Localizer.getMessage( - "jsp.error.xml.badStandardAction", - localName), - locator); - } - - return node; - } - - /* - * Checks if the XML element with the given tag name is a custom action, - * and returns the corresponding Node object. - */ - private Node parseCustomAction( - String qName, - String localName, - String uri, - Attributes nonTaglibAttrs, - Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, - Mark start, - Node parent) - throws SAXException { - - // Check if this is a user-defined (custom) tag - TagLibraryInfo tagLibInfo = pageInfo.getTaglib(uri); - if (tagLibInfo == null) { - return null; - } - - TagInfo tagInfo = tagLibInfo.getTag(localName); - TagFileInfo tagFileInfo = tagLibInfo.getTagFile(localName); - if (tagInfo == null && tagFileInfo == null) { - throw new SAXException( - Localizer.getMessage("jsp.error.xml.bad_tag", localName, uri)); - } - Class tagHandlerClass = null; - if (tagInfo != null) { - String handlerClassName = tagInfo.getTagClassName(); - try { - tagHandlerClass = - ctxt.getClassLoader().loadClass(handlerClassName); - } catch (Exception e) { - throw new SAXException( - Localizer.getMessage("jsp.error.loadclass.taghandler", - handlerClassName, - qName), - e); - } - } - - String prefix = getPrefix(qName); - - Node.CustomTag ret = null; - if (tagInfo != null) { - ret = - new Node.CustomTag( - qName, - prefix, - localName, - uri, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - parent, - tagInfo, - tagHandlerClass); - } else { - ret = - new Node.CustomTag( - qName, - prefix, - localName, - uri, - nonTaglibAttrs, - nonTaglibXmlnsAttrs, - taglibAttrs, - start, - parent, - tagFileInfo); - } - - return ret; - } - - /* - * Creates the tag library associated with the given uri namespace, and - * returns it. - * - * @param prefix The prefix of the xmlns attribute - * @param uri The uri namespace (value of the xmlns attribute) - * - * @return The tag library associated with the given uri namespace - */ - private TagLibraryInfo getTaglibInfo(String prefix, String uri) - throws JasperException { - - TagLibraryInfo result = null; - - if (uri.startsWith(URN_JSPTAGDIR)) { - // uri (of the form "urn:jsptagdir:path") references tag file dir - String tagdir = uri.substring(URN_JSPTAGDIR.length()); - result = - new ImplicitTagLibraryInfo( - ctxt, - parserController, - pageInfo, - prefix, - tagdir, - err); - } else { - // uri references TLD file - boolean isPlainUri = false; - if (uri.startsWith(URN_JSPTLD)) { - // uri is of the form "urn:jsptld:path" - uri = uri.substring(URN_JSPTLD.length()); - } else { - isPlainUri = true; - } - - String[] location = ctxt.getTldLocation(uri); - if (location != null || !isPlainUri) { - if (ctxt.getOptions().isCaching()) { - result = (TagLibraryInfoImpl) ctxt.getOptions().getCache().get(uri); - } - if (result == null) { - /* - * If the uri value is a plain uri, a translation error must - * not be generated if the uri is not found in the taglib map. - * Instead, any actions in the namespace defined by the uri - * value must be treated as uninterpreted. - */ - result = - new TagLibraryInfoImpl( - ctxt, - parserController, - pageInfo, - prefix, - uri, - location, - err); - if (ctxt.getOptions().isCaching()) { - ctxt.getOptions().getCache().put(uri, result); - } - } - } - } - - return result; - } - - /* - * Ensures that the given body only contains nodes that are instances of - * TemplateText. - * - * This check is performed only for the body of a scripting (that is: - * declaration, scriptlet, or expression) element, after the end tag of a - * scripting element has been reached. - */ - private void checkScriptingBody(Node.ScriptingElement scriptingElem) - throws SAXException { - Node.Nodes body = scriptingElem.getBody(); - if (body != null) { - int size = body.size(); - for (int i = 0; i < size; i++) { - Node n = body.getNode(i); - if (!(n instanceof Node.TemplateText)) { - String elemType = SCRIPTLET_ACTION; - if (scriptingElem instanceof Node.Declaration) - elemType = DECLARATION_ACTION; - if (scriptingElem instanceof Node.Expression) - elemType = EXPRESSION_ACTION; - String msg = - Localizer.getMessage( - "jsp.error.parse.xml.scripting.invalid.body", - elemType); - throw new SAXException(msg); - } - } - } - } - - /* - * Parses the given file included via an include directive. - * - * @param fname The path to the included resource, as specified by the - * 'file' attribute of the include directive - * @param parent The Node representing the include directive - */ - private void processIncludeDirective(String fname, Node parent) - throws SAXException { - - if (fname == null) { - return; - } - - try { - parserController.parse(fname, parent, null); - } catch (FileNotFoundException fnfe) { - throw new SAXParseException( - Localizer.getMessage("jsp.error.file.not.found", fname), - locator, - fnfe); - } catch (Exception e) { - throw new SAXException(e); - } - } - - /* - * Checks an element's given URI, qname, and attributes to see if any - * of them hijack the 'jsp' prefix, that is, bind it to a namespace other - * than http://java.sun.com/JSP/Page. - * - * @param uri The element's URI - * @param qName The element's qname - * @param attrs The element's attributes - */ - private void checkPrefixes(String uri, String qName, Attributes attrs) { - - checkPrefix(uri, qName); - - int len = attrs.getLength(); - for (int i = 0; i < len; i++) { - checkPrefix(attrs.getURI(i), attrs.getQName(i)); - } - } - - /* - * Checks the given URI and qname to see if they hijack the 'jsp' prefix, - * which would be the case if qName contained the 'jsp' prefix and - * uri was different from http://java.sun.com/JSP/Page. - * - * @param uri The URI to check - * @param qName The qname to check - */ - private void checkPrefix(String uri, String qName) { - - String prefix = getPrefix(qName); - if (prefix.length() > 0) { - pageInfo.addPrefix(prefix); - if ("jsp".equals(prefix) && !JSP_URI.equals(uri)) { - pageInfo.setIsJspPrefixHijacked(true); - } - } - } - - private String getPrefix(String qName) { - int index = qName.indexOf(':'); - if (index != -1) { - return qName.substring(0, index); - } - return ""; - } - - /* - * Gets SAXParser. - * - * @param validating Indicates whether the requested SAXParser should - * be validating - * @param jspDocParser The JSP document parser - * - * @return The SAXParser - */ - private static SAXParser getSAXParser( - boolean validating, - JspDocumentParser jspDocParser) - throws Exception { - - SAXParserFactory factory = SAXParserFactory.newInstance(); - factory.setNamespaceAware(true); - - // Preserve xmlns attributes - factory.setFeature( - "http://xml.org/sax/features/namespace-prefixes", - true); - factory.setValidating(validating); - //factory.setFeature( - // "http://xml.org/sax/features/validation", - // validating); - - // Configure the parser - SAXParser saxParser = factory.newSAXParser(); - XMLReader xmlReader = saxParser.getXMLReader(); - xmlReader.setProperty(LEXICAL_HANDLER_PROPERTY, jspDocParser); - xmlReader.setErrorHandler(jspDocParser); - - return saxParser; - } - - /* - * Exception indicating that a DOCTYPE declaration is present, but - * validation is turned off. - */ - private static class EnableDTDValidationException - extends SAXParseException { - - EnableDTDValidationException(String message, Locator loc) { - super(message, loc); - } - } - - private static String getBodyType(Node.CustomTag custom) { - - if (custom.getTagInfo() != null) { - return custom.getTagInfo().getBodyContent(); - } - - return custom.getTagFileInfo().getTagInfo().getBodyContent(); - } - - private boolean isTagDependent(Node n) { - - if (n instanceof Node.CustomTag) { - String bodyType = getBodyType((Node.CustomTag) n); - return - TagInfo.BODY_CONTENT_TAG_DEPENDENT.equalsIgnoreCase(bodyType); - } - return false; - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspReader.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspReader.java deleted file mode 100644 index 4df569f91..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspReader.java +++ /dev/null @@ -1,657 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.CharArrayWriter; -import java.io.FileNotFoundException; -import java.io.IOException; -import java.io.InputStreamReader; -import java.util.List; -import java.util.Vector; -import java.util.jar.JarFile; -import java.net.URL; -import java.net.MalformedURLException; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * JspReader is an input buffer for the JSP parser. It should allow - * unlimited lookahead and pushback. It also has a bunch of parsing - * utility methods for understanding htmlesque thingies. - * - * @author Anil K. Vijendran - * @author Anselm Baird-Smith - * @author Harish Prabandham - * @author Rajiv Mordani - * @author Mandar Raje - * @author Danno Ferrin - * @author Kin-man Chung - * @author Shawn Bayern - * @author Mark Roth - */ - -class JspReader { - - /** - * Logger. - */ - private Log log = LogFactory.getLog(JspReader.class); - - /** - * The current spot in the file. - */ - private Mark current; - - /** - * What is this? - */ - private String master; - - /** - * The list of source files. - */ - private List sourceFiles; - - /** - * The current file ID (-1 indicates an error or no file). - */ - private int currFileId; - - /** - * Seems redundant. - */ - private int size; - - /** - * The compilation context. - */ - private JspCompilationContext context; - - /** - * The Jasper error dispatcher. - */ - private ErrorDispatcher err; - - /** - * Set to true when using the JspReader on a single file where we read up - * to the end and reset to the beginning many times. - * (as in ParserController.figureOutJspDocument()). - */ - private boolean singleFile; - - /** - * Constructor. - * - * @param ctxt The compilation context - * @param fname The file name - * @param encoding The file encoding - * @param jarFile ? - * @param err The error dispatcher - * @throws JasperException If a Jasper-internal error occurs - * @throws FileNotFoundException If the JSP file is not found (or is unreadable) - * @throws IOException If an IO-level error occurs, e.g. reading the file - */ - public JspReader(JspCompilationContext ctxt, - String fname, - String encoding, - JarFile jarFile, - ErrorDispatcher err) - throws JasperException, FileNotFoundException, IOException { - - this(ctxt, fname, encoding, - JspUtil.getReader(fname, encoding, jarFile, ctxt, err), - err); - } - - /** - * Constructor: same as above constructor but with initialized reader - * to the file given. - */ - public JspReader(JspCompilationContext ctxt, - String fname, - String encoding, - InputStreamReader reader, - ErrorDispatcher err) - throws JasperException, FileNotFoundException { - - this.context = ctxt; - this.err = err; - sourceFiles = new Vector(); - currFileId = 0; - size = 0; - singleFile = false; - pushFile(fname, encoding, reader); - } - - /** - * @return JSP compilation context with which this JspReader is - * associated - */ - JspCompilationContext getJspCompilationContext() { - return context; - } - - /** - * Returns the file at the given position in the list. - * - * @param fileid The file position in the list - * @return The file at that position, if found, null otherwise - */ - String getFile(final int fileid) { - return (String) sourceFiles.get(fileid); - } - - /** - * Checks if the current file has more input. - * - * @return True if more reading is possible - * @throws JasperException if an error occurs - */ - boolean hasMoreInput() throws JasperException { - if (current.cursor >= current.stream.length) { - if (singleFile) return false; - while (popFile()) { - if (current.cursor < current.stream.length) return true; - } - return false; - } - return true; - } - - int nextChar() throws JasperException { - if (!hasMoreInput()) - return -1; - - int ch = current.stream[current.cursor]; - - current.cursor++; - - if (ch == '\n') { - current.line++; - current.col = 0; - } else { - current.col++; - } - return ch; - } - - /** - * Back up the current cursor by one char, assumes current.cursor > 0, - * and that the char to be pushed back is not '\n'. - */ - void pushChar() { - current.cursor--; - current.col--; - } - - String getText(Mark start, Mark stop) throws JasperException { - Mark oldstart = mark(); - reset(start); - CharArrayWriter caw = new CharArrayWriter(); - while (!stop.equals(mark())) - caw.write(nextChar()); - caw.close(); - reset(oldstart); - return caw.toString(); - } - - int peekChar() throws JasperException { - if (!hasMoreInput()) - return -1; - return current.stream[current.cursor]; - } - - Mark mark() { - return new Mark(current); - } - - void reset(Mark mark) { - current = new Mark(mark); - } - - boolean matchesIgnoreCase(String string) throws JasperException { - Mark mark = mark(); - int ch = 0; - int i = 0; - do { - ch = nextChar(); - if (Character.toLowerCase((char) ch) != string.charAt(i++)) { - reset(mark); - return false; - } - } while (i < string.length()); - reset(mark); - return true; - } - - /** - * search the stream for a match to a string - * @param string The string to match - * @return true is one is found, the current position - * in stream is positioned after the search string, - * false otherwise, position in stream unchanged. - */ - boolean matches(String string) throws JasperException { - Mark mark = mark(); - int ch = 0; - int i = 0; - do { - ch = nextChar(); - if (((char) ch) != string.charAt(i++)) { - reset(mark); - return false; - } - } while (i < string.length()); - return true; - } - - boolean matchesETag(String tagName) throws JasperException { - Mark mark = mark(); - - if (!matches("') - return true; - - reset(mark); - return false; - } - - boolean matchesETagWithoutLessThan(String tagName) - throws JasperException - { - Mark mark = mark(); - - if (!matches("/" + tagName)) - return false; - skipSpaces(); - if (nextChar() == '>') - return true; - - reset(mark); - return false; - } - - - /** - * Looks ahead to see if there are optional spaces followed by - * the given String. If so, true is returned and those spaces and - * characters are skipped. If not, false is returned and the - * position is restored to where we were before. - */ - boolean matchesOptionalSpacesFollowedBy( String s ) - throws JasperException - { - Mark mark = mark(); - - skipSpaces(); - boolean result = matches( s ); - if( !result ) { - reset( mark ); - } - - return result; - } - - int skipSpaces() throws JasperException { - int i = 0; - while (hasMoreInput() && isSpace()) { - i++; - nextChar(); - } - return i; - } - - /** - * Skip until the given string is matched in the stream. - * When returned, the context is positioned past the end of the match. - * - * @param s The String to match. - * @return A non-null Mark instance (positioned immediately - * before the search string) if found, null - * otherwise. - */ - Mark skipUntil(String limit) throws JasperException { - Mark ret = null; - int limlen = limit.length(); - int ch; - - skip: - for (ret = mark(), ch = nextChar() ; ch != -1 ; - ret = mark(), ch = nextChar()) { - if (ch == limit.charAt(0)) { - Mark restart = mark(); - for (int i = 1 ; i < limlen ; i++) { - if (peekChar() == limit.charAt(i)) - nextChar(); - else { - reset(restart); - continue skip; - } - } - return ret; - } - } - return null; - } - - /** - * Skip until the given string is matched in the stream, but ignoring - * chars initially escaped by a '\'. - * When returned, the context is positioned past the end of the match. - * - * @param s The String to match. - * @return A non-null Mark instance (positioned immediately - * before the search string) if found, null - * otherwise. - */ - Mark skipUntilIgnoreEsc(String limit) throws JasperException { - Mark ret = null; - int limlen = limit.length(); - int ch; - int prev = 'x'; // Doesn't matter - - skip: - for (ret = mark(), ch = nextChar() ; ch != -1 ; - ret = mark(), prev = ch, ch = nextChar()) { - if (ch == '\\' && prev == '\\') { - ch = 0; // Double \ is not an escape char anymore - } - else if (ch == limit.charAt(0) && prev != '\\') { - for (int i = 1 ; i < limlen ; i++) { - if (peekChar() == limit.charAt(i)) - nextChar(); - else - continue skip; - } - return ret; - } - } - return null; - } - - /** - * Skip until the given end tag is matched in the stream. - * When returned, the context is positioned past the end of the tag. - * - * @param tag The name of the tag whose ETag () to match. - * @return A non-null Mark instance (positioned immediately - * before the ETag) if found, null otherwise. - */ - Mark skipUntilETag(String tag) throws JasperException { - Mark ret = skipUntil("') - ret = null; - } - return ret; - } - - final boolean isSpace() throws JasperException { - // Note: If this logic changes, also update Node.TemplateText.rtrim() - return peekChar() <= ' '; - } - - /** - * Parse a space delimited token. - * If quoted the token will consume all characters up to a matching quote, - * otherwise, it consumes up to the first delimiter character. - * - * @param quoted If true accept quoted strings. - */ - String parseToken(boolean quoted) throws JasperException { - StringBuffer stringBuffer = new StringBuffer(); - skipSpaces(); - stringBuffer.setLength(0); - - if (!hasMoreInput()) { - return ""; - } - - int ch = peekChar(); - - if (quoted) { - if (ch == '"' || ch == '\'') { - - char endQuote = ch == '"' ? '"' : '\''; - // Consume the open quote: - ch = nextChar(); - for (ch = nextChar(); ch != -1 && ch != endQuote; - ch = nextChar()) { - if (ch == '\\') - ch = nextChar(); - stringBuffer.append((char) ch); - } - // Check end of quote, skip closing quote: - if (ch == -1) { - err.jspError(mark(), "jsp.error.quotes.unterminated"); - } - } else { - err.jspError(mark(), "jsp.error.attr.quoted"); - } - } else { - if (!isDelimiter()) { - // Read value until delimiter is found: - do { - ch = nextChar(); - // Take care of the quoting here. - if (ch == '\\') { - if (peekChar() == '"' || peekChar() == '\'' || - peekChar() == '>' || peekChar() == '%') - ch = nextChar(); - } - stringBuffer.append((char) ch); - } while (!isDelimiter()); - } - } - - return stringBuffer.toString(); - } - - void setSingleFile(boolean val) { - singleFile = val; - } - - - /** - * Gets the URL for the given path name. - * - * @param path Path name - * - * @return URL for the given path name. - * - * @exception MalformedURLException if the path name is not given in - * the correct form - */ - URL getResource(String path) throws MalformedURLException { - return context.getResource(path); - } - - - /** - * Parse utils - Is current character a token delimiter ? - * Delimiters are currently defined to be =, >, <, ", and ' or any - * any space character as defined by isSpace. - * - * @return A boolean. - */ - private boolean isDelimiter() throws JasperException { - if (! isSpace()) { - int ch = peekChar(); - // Look for a single-char work delimiter: - if (ch == '=' || ch == '>' || ch == '"' || ch == '\'' - || ch == '/') { - return true; - } - // Look for an end-of-comment or end-of-tag: - if (ch == '-') { - Mark mark = mark(); - if (((ch = nextChar()) == '>') - || ((ch == '-') && (nextChar() == '>'))) { - reset(mark); - return true; - } else { - reset(mark); - return false; - } - } - return false; - } else { - return true; - } - } - - /** - * Register a new source file. - * This method is used to implement file inclusion. Each included file - * gets a unique identifier (which is the index in the array of source - * files). - * - * @return The index of the now registered file. - */ - private int registerSourceFile(final String file) { - if (sourceFiles.contains(file)) { - return -1; - } - - sourceFiles.add(file); - this.size++; - - return sourceFiles.size() - 1; - } - - - /** - * Unregister the source file. - * This method is used to implement file inclusion. Each included file - * gets a uniq identifier (which is the index in the array of source - * files). - * - * @return The index of the now registered file. - */ - private int unregisterSourceFile(final String file) { - if (!sourceFiles.contains(file)) { - return -1; - } - - sourceFiles.remove(file); - this.size--; - return sourceFiles.size() - 1; - } - - /** - * Push a file (and its associated Stream) on the file stack. THe - * current position in the current file is remembered. - */ - private void pushFile(String file, String encoding, - InputStreamReader reader) - throws JasperException, FileNotFoundException { - - // Register the file - String longName = file; - - int fileid = registerSourceFile(longName); - - if (fileid == -1) { - // Bugzilla 37407: http://issues.apache.org/bugzilla/show_bug.cgi?id=37407 - if(reader != null) { - try { - reader.close(); - } catch (Exception any) { - if(log.isDebugEnabled()) { - log.debug("Exception closing reader: ", any); - } - } - } - - err.jspError("jsp.error.file.already.registered", file); - } - - currFileId = fileid; - - try { - CharArrayWriter caw = new CharArrayWriter(); - char buf[] = new char[1024]; - for (int i = 0 ; (i = reader.read(buf)) != -1 ;) - caw.write(buf, 0, i); - caw.close(); - if (current == null) { - current = new Mark(this, caw.toCharArray(), fileid, - getFile(fileid), master, encoding); - } else { - current.pushStream(caw.toCharArray(), fileid, getFile(fileid), - longName, encoding); - } - } catch (Throwable ex) { - log.error("Exception parsing file ", ex); - // Pop state being constructed: - popFile(); - err.jspError("jsp.error.file.cannot.read", file); - } finally { - if (reader != null) { - try { - reader.close(); - } catch (Exception any) { - if(log.isDebugEnabled()) { - log.debug("Exception closing reader: ", any); - } - } - } - } - } - - /** - * Pop a file from the file stack. The field "current" is retored - * to the value to point to the previous files, if any, and is set - * to null otherwise. - * @return true is there is a previous file on the stack. - * false otherwise. - */ - private boolean popFile() throws JasperException { - - // Is stack created ? (will happen if the Jsp file we're looking at is - // missing. - if (current == null || currFileId < 0) { - return false; - } - - // Restore parser state: - String fName = getFile(currFileId); - currFileId = unregisterSourceFile(fName); - if (currFileId < -1) { - err.jspError("jsp.error.file.not.registered", fName); - } - - Mark previous = current.popStream(); - if (previous != null) { - master = current.baseDir; - current = previous; - return true; - } - // Note that although the current file is undefined here, "current" - // is not set to null just for convience, for it maybe used to - // set the current (undefined) position. - return false; - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspRuntimeContext.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspRuntimeContext.java deleted file mode 100644 index 0e47c0abf..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/JspRuntimeContext.java +++ /dev/null @@ -1,446 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.File; -import java.io.FileNotFoundException; -import java.io.FilePermission; -import java.net.URL; -import java.net.URLClassLoader; -import java.security.CodeSource; -import java.security.PermissionCollection; -import java.security.Policy; -import java.security.cert.Certificate; -import java.util.Iterator; -import java.util.Map; -import java.util.concurrent.ConcurrentHashMap; - -import javax.servlet.ServletContext; -import javax.servlet.jsp.JspFactory; - -import org.apache.jasper.Constants; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.Options; -import org.apache.jasper.runtime.JspFactoryImpl; -import org.apache.jasper.security.SecurityClassLoad; -import org.apache.jasper.servlet.JspServletWrapper; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * Class for tracking JSP compile time file dependencies when the - * &060;%@include file="..."%&062; directive is used. - * - * A background thread periodically checks the files a JSP page - * is dependent upon. If a dpendent file changes the JSP page - * which included it is recompiled. - * - * Only used if a web application context is a directory. - * - * @author Glenn L. Nielsen - * @version $Revision: 505593 $ - */ -public final class JspRuntimeContext { - - // Logger - private Log log = LogFactory.getLog(JspRuntimeContext.class); - - /* - * Counts how many times the webapp's JSPs have been reloaded. - */ - private int jspReloadCount; - - /** - * Preload classes required at runtime by a JSP servlet so that - * we don't get a defineClassInPackage security exception. - */ - static { - JspFactoryImpl factory = new JspFactoryImpl(); - SecurityClassLoad.securityClassLoad(factory.getClass().getClassLoader()); - if( System.getSecurityManager() != null ) { - String basePackage = "org.apache.jasper."; - try { - factory.getClass().getClassLoader().loadClass( basePackage + - "runtime.JspFactoryImpl$PrivilegedGetPageContext"); - factory.getClass().getClassLoader().loadClass( basePackage + - "runtime.JspFactoryImpl$PrivilegedReleasePageContext"); - factory.getClass().getClassLoader().loadClass( basePackage + - "runtime.JspRuntimeLibrary"); - factory.getClass().getClassLoader().loadClass( basePackage + - "runtime.JspRuntimeLibrary$PrivilegedIntrospectHelper"); - factory.getClass().getClassLoader().loadClass( basePackage + - "runtime.ServletResponseWrapperInclude"); - factory.getClass().getClassLoader().loadClass( basePackage + - "servlet.JspServletWrapper"); - } catch (ClassNotFoundException ex) { - throw new IllegalStateException(ex); - } - } - - JspFactory.setDefaultFactory(factory); - } - - // ----------------------------------------------------------- Constructors - - /** - * Create a JspRuntimeContext for a web application context. - * - * Loads in any previously generated dependencies from file. - * - * @param context ServletContext for web application - */ - public JspRuntimeContext(ServletContext context, Options options) { - - this.context = context; - this.options = options; - - // Get the parent class loader - parentClassLoader = - (URLClassLoader) Thread.currentThread().getContextClassLoader(); - if (parentClassLoader == null) { - parentClassLoader = - (URLClassLoader)this.getClass().getClassLoader(); - } - - if (log.isDebugEnabled()) { - if (parentClassLoader != null) { - log.debug(Localizer.getMessage("jsp.message.parent_class_loader_is", - parentClassLoader.toString())); - } else { - log.debug(Localizer.getMessage("jsp.message.parent_class_loader_is", - "")); - } - } - - initClassPath(); - - if (context instanceof org.apache.jasper.servlet.JspCServletContext) { - return; - } - - if (Constants.IS_SECURITY_ENABLED) { - initSecurity(); - } - - // If this web application context is running from a - // directory, start the background compilation thread - String appBase = context.getRealPath("/"); - if (!options.getDevelopment() - && appBase != null - && options.getCheckInterval() > 0) { - lastCheck = System.currentTimeMillis(); - } - } - - // ----------------------------------------------------- Instance Variables - - /** - * This web applications ServletContext - */ - private ServletContext context; - private Options options; - private URLClassLoader parentClassLoader; - private PermissionCollection permissionCollection; - private CodeSource codeSource; - private String classpath; - private long lastCheck = -1L; - - /** - * Maps JSP pages to their JspServletWrapper's - */ - private Map jsps = new ConcurrentHashMap(); - - - // ------------------------------------------------------ Public Methods - - /** - * Add a new JspServletWrapper. - * - * @param jspUri JSP URI - * @param jsw Servlet wrapper for JSP - */ - public void addWrapper(String jspUri, JspServletWrapper jsw) { - jsps.put(jspUri, jsw); - } - - /** - * Get an already existing JspServletWrapper. - * - * @param jspUri JSP URI - * @return JspServletWrapper for JSP - */ - public JspServletWrapper getWrapper(String jspUri) { - return jsps.get(jspUri); - } - - /** - * Remove a JspServletWrapper. - * - * @param jspUri JSP URI of JspServletWrapper to remove - */ - public void removeWrapper(String jspUri) { - jsps.remove(jspUri); - } - - /** - * Returns the number of JSPs for which JspServletWrappers exist, i.e., - * the number of JSPs that have been loaded into the webapp. - * - * @return The number of JSPs that have been loaded into the webapp - */ - public int getJspCount() { - return jsps.size(); - } - - /** - * Get the SecurityManager Policy CodeSource for this web - * applicaiton context. - * - * @return CodeSource for JSP - */ - public CodeSource getCodeSource() { - return codeSource; - } - - /** - * Get the parent URLClassLoader. - * - * @return URLClassLoader parent - */ - public URLClassLoader getParentClassLoader() { - return parentClassLoader; - } - - /** - * Get the SecurityManager PermissionCollection for this - * web application context. - * - * @return PermissionCollection permissions - */ - public PermissionCollection getPermissionCollection() { - return permissionCollection; - } - - /** - * Process a "destory" event for this web application context. - */ - public void destroy() { - Iterator servlets = jsps.values().iterator(); - while (servlets.hasNext()) { - ((JspServletWrapper) servlets.next()).destroy(); - } - } - - /** - * Increments the JSP reload counter. - */ - public synchronized void incrementJspReloadCount() { - jspReloadCount++; - } - - /** - * Resets the JSP reload counter. - * - * @param count Value to which to reset the JSP reload counter - */ - public synchronized void setJspReloadCount(int count) { - this.jspReloadCount = count; - } - - /** - * Gets the current value of the JSP reload counter. - * - * @return The current value of the JSP reload counter - */ - public int getJspReloadCount() { - return jspReloadCount; - } - - - /** - * Method used by background thread to check the JSP dependencies - * registered with this class for JSP's. - */ - public void checkCompile() { - - if (lastCheck < 0) { - // Checking was disabled - return; - } - long now = System.currentTimeMillis(); - if (now > (lastCheck + (options.getCheckInterval() * 1000L))) { - lastCheck = now; - } else { - return; - } - - Object [] wrappers = jsps.values().toArray(); - for (int i = 0; i < wrappers.length; i++ ) { - JspServletWrapper jsw = (JspServletWrapper)wrappers[i]; - JspCompilationContext ctxt = jsw.getJspEngineContext(); - // JspServletWrapper also synchronizes on this when - // it detects it has to do a reload - synchronized(jsw) { - try { - ctxt.compile(); - } catch (FileNotFoundException ex) { - ctxt.incrementRemoved(); - } catch (Throwable t) { - jsw.getServletContext().log("Background compile failed", - t); - } - } - } - - } - - /** - * The classpath that is passed off to the Java compiler. - */ - public String getClassPath() { - return classpath; - } - - - // -------------------------------------------------------- Private Methods - - - /** - * Method used to initialize classpath for compiles. - */ - private void initClassPath() { - - URL [] urls = parentClassLoader.getURLs(); - StringBuffer cpath = new StringBuffer(); - String sep = System.getProperty("path.separator"); - - for(int i = 0; i < urls.length; i++) { - // Tomcat 4 can use URL's other than file URL's, - // a protocol other than file: will generate a - // bad file system path, so only add file: - // protocol URL's to the classpath. - - if( urls[i].getProtocol().equals("file") ) { - cpath.append((String)urls[i].getFile()+sep); - } - } - - cpath.append(options.getScratchDir() + sep); - - String cp = (String) context.getAttribute(Constants.SERVLET_CLASSPATH); - if (cp == null || cp.equals("")) { - cp = options.getClassPath(); - } - - classpath = cpath.toString() + cp; - - if(log.isDebugEnabled()) { - log.debug("Compilation classpath initialized: " + getClassPath()); - } - } - - /** - * Method used to initialize SecurityManager data. - */ - private void initSecurity() { - - // Setup the PermissionCollection for this web app context - // based on the permissions configured for the root of the - // web app context directory, then add a file read permission - // for that directory. - Policy policy = Policy.getPolicy(); - if( policy != null ) { - try { - // Get the permissions for the web app context - String docBase = context.getRealPath("/"); - if( docBase == null ) { - docBase = options.getScratchDir().toString(); - } - String codeBase = docBase; - if (!codeBase.endsWith(File.separator)){ - codeBase = codeBase + File.separator; - } - File contextDir = new File(codeBase); - URL url = contextDir.getCanonicalFile().toURL(); - codeSource = new CodeSource(url,(Certificate[])null); - permissionCollection = policy.getPermissions(codeSource); - - // Create a file read permission for web app context directory - if (!docBase.endsWith(File.separator)){ - permissionCollection.add - (new FilePermission(docBase,"read")); - docBase = docBase + File.separator; - } else { - permissionCollection.add - (new FilePermission - (docBase.substring(0,docBase.length() - 1),"read")); - } - docBase = docBase + "-"; - permissionCollection.add(new FilePermission(docBase,"read")); - - // Create a file read permission for web app tempdir (work) - // directory - String workDir = options.getScratchDir().toString(); - if (!workDir.endsWith(File.separator)){ - permissionCollection.add - (new FilePermission(workDir,"read")); - workDir = workDir + File.separator; - } - workDir = workDir + "-"; - permissionCollection.add(new FilePermission(workDir,"read")); - - // Allow the JSP to access org.apache.jasper.runtime.HttpJspBase - permissionCollection.add( new RuntimePermission( - "accessClassInPackage.org.apache.jasper.runtime") ); - - if (parentClassLoader instanceof URLClassLoader) { - URL [] urls = parentClassLoader.getURLs(); - String jarUrl = null; - String jndiUrl = null; - for (int i=0; i') { - caw.write('%'); - caw.write('>'); - i = i + 2; - } else { - caw.write(chars[i]); - } - } - return caw.toCharArray(); - } - - public static char[] escapeQuotes (char []chars) { - // Prescan to convert %\> to %> - String s = new String(chars); - while (true) { - int n = s.indexOf("%\\>"); - if (n < 0) - break; - StringBuffer sb = new StringBuffer(s.substring(0, n)); - sb.append("%>"); - sb.append(s.substring(n + 3)); - s = sb.toString(); - } - chars = s.toCharArray(); - return (chars); - - - // Escape all backslashes not inside a Java string literal - /* - CharArrayWriter caw = new CharArrayWriter(); - boolean inJavaString = false; - for (int i = 0; i < chars.length; i++) { - if (chars[i] == '"') inJavaString = !inJavaString; - // escape out the escape character - if (!inJavaString && (chars[i] == '\\')) caw.write('\\'); - caw.write(chars[i]); - } - return caw.toCharArray(); - */ - } - - /** - * Checks if the token is a runtime expression. - * In standard JSP syntax, a runtime expression starts with '<%' and - * ends with '%>'. When the JSP document is in XML syntax, a runtime - * expression starts with '%=' and ends with '%'. - * - * @param token The token to be checked - * return whether the token is a runtime expression or not. - */ - public static boolean isExpression(String token, boolean isXml) { - String openExpr; - String closeExpr; - if (isXml) { - openExpr = OPEN_EXPR_XML; - closeExpr = CLOSE_EXPR_XML; - } else { - openExpr = OPEN_EXPR; - closeExpr = CLOSE_EXPR; - } - if (token.startsWith(openExpr) && token.endsWith(closeExpr)) { - return true; - } else { - return false; - } - } - - /** - * @return the "expression" part of a runtime expression, - * taking the delimiters out. - */ - public static String getExpr (String expression, boolean isXml) { - String returnString; - String openExpr; - String closeExpr; - if (isXml) { - openExpr = OPEN_EXPR_XML; - closeExpr = CLOSE_EXPR_XML; - } else { - openExpr = OPEN_EXPR; - closeExpr = CLOSE_EXPR; - } - int length = expression.length(); - if (expression.startsWith(openExpr) && - expression.endsWith(closeExpr)) { - returnString = expression.substring( - openExpr.length(), length - closeExpr.length()); - } else { - returnString = ""; - } - return returnString; - } - - /** - * Takes a potential expression and converts it into XML form - */ - public static String getExprInXml(String expression) { - String returnString; - int length = expression.length(); - - if (expression.startsWith(OPEN_EXPR) - && expression.endsWith(CLOSE_EXPR)) { - returnString = expression.substring (1, length - 1); - } else { - returnString = expression; - } - - return escapeXml(returnString.replace(Constants.ESC, '$')); - } - - /** - * Checks to see if the given scope is valid. - * - * @param scope The scope to be checked - * @param n The Node containing the 'scope' attribute whose value is to be - * checked - * @param err error dispatcher - * - * @throws JasperException if scope is not null and different from - * "page", "request", "session", and - * "application" - */ - public static void checkScope(String scope, Node n, ErrorDispatcher err) - throws JasperException { - if (scope != null && !scope.equals("page") && !scope.equals("request") - && !scope.equals("session") && !scope.equals("application")) { - err.jspError(n, "jsp.error.invalid.scope", scope); - } - } - - /** - * Checks if all mandatory attributes are present and if all attributes - * present have valid names. Checks attributes specified as XML-style - * attributes as well as attributes specified using the jsp:attribute - * standard action. - */ - public static void checkAttributes(String typeOfTag, - Node n, - ValidAttribute[] validAttributes, - ErrorDispatcher err) - throws JasperException { - Attributes attrs = n.getAttributes(); - Mark start = n.getStart(); - boolean valid = true; - - // AttributesImpl.removeAttribute is broken, so we do this... - int tempLength = (attrs == null) ? 0 : attrs.getLength(); - Vector temp = new Vector(tempLength, 1); - for (int i = 0; i < tempLength; i++) { - String qName = attrs.getQName(i); - if ((!qName.equals("xmlns")) && (!qName.startsWith("xmlns:"))) - temp.addElement(qName); - } - - // Add names of attributes specified using jsp:attribute - Node.Nodes tagBody = n.getBody(); - if( tagBody != null ) { - int numSubElements = tagBody.size(); - for( int i = 0; i < numSubElements; i++ ) { - Node node = tagBody.getNode( i ); - if( node instanceof Node.NamedAttribute ) { - String attrName = node.getAttributeValue( "name" ); - temp.addElement( attrName ); - // Check if this value appear in the attribute of the node - if (n.getAttributeValue(attrName) != null) { - err.jspError(n, "jsp.error.duplicate.name.jspattribute", - attrName); - } - } - else { - // Nothing can come before jsp:attribute, and only - // jsp:body can come after it. - break; - } - } - } - - /* - * First check to see if all the mandatory attributes are present. - * If so only then proceed to see if the other attributes are valid - * for the particular tag. - */ - String missingAttribute = null; - - for (int i = 0; i < validAttributes.length; i++) { - int attrPos; - if (validAttributes[i].mandatory) { - attrPos = temp.indexOf(validAttributes[i].name); - if (attrPos != -1) { - temp.remove(attrPos); - valid = true; - } else { - valid = false; - missingAttribute = validAttributes[i].name; - break; - } - } - } - - // If mandatory attribute is missing then the exception is thrown - if (!valid) - err.jspError(start, "jsp.error.mandatory.attribute", typeOfTag, - missingAttribute); - - // Check to see if there are any more attributes for the specified tag. - int attrLeftLength = temp.size(); - if (attrLeftLength == 0) - return; - - // Now check to see if the rest of the attributes are valid too. - String attribute = null; - - for (int j = 0; j < attrLeftLength; j++) { - valid = false; - attribute = (String) temp.elementAt(j); - for (int i = 0; i < validAttributes.length; i++) { - if (attribute.equals(validAttributes[i].name)) { - valid = true; - break; - } - } - if (!valid) - err.jspError(start, "jsp.error.invalid.attribute", typeOfTag, - attribute); - } - // XXX *could* move EL-syntax validation here... (sb) - } - - public static String escapeQueryString(String unescString) { - if ( unescString == null ) - return null; - - String escString = ""; - String shellSpChars = "\\\""; - - for(int index=0; index') { - sb.append(">"); - } else if (c == '\'') { - sb.append("'"); - } else if (c == '&') { - sb.append("&"); - } else if (c == '"') { - sb.append("""); - } else { - sb.append(c); - } - } - return sb.toString(); - } - - /** - * Replaces any occurrences of the character replace with the - * string with. - */ - public static String replace(String name, char replace, String with) { - StringBuffer buf = new StringBuffer(); - int begin = 0; - int end; - int last = name.length(); - - while (true) { - end = name.indexOf(replace, begin); - if (end < 0) { - end = last; - } - buf.append(name.substring(begin, end)); - if (end == last) { - break; - } - buf.append(with); - begin = end + 1; - } - - return buf.toString(); - } - - public static class ValidAttribute { - String name; - boolean mandatory; - boolean rtexprvalue; // not used now - - public ValidAttribute (String name, boolean mandatory, - boolean rtexprvalue ) - { - this.name = name; - this.mandatory = mandatory; - this.rtexprvalue = rtexprvalue; - } - - public ValidAttribute (String name, boolean mandatory) { - this( name, mandatory, false ); - } - - public ValidAttribute (String name) { - this (name, false); - } - } - - /** - * Convert a String value to 'boolean'. - * Besides the standard conversions done by - * Boolean.valueOf(s).booleanValue(), the value "yes" - * (ignore case) is also converted to 'true'. - * If 's' is null, then 'false' is returned. - * - * @param s the string to be converted - * @return the boolean value associated with the string s - */ - public static boolean booleanValue(String s) { - boolean b = false; - if (s != null) { - if (s.equalsIgnoreCase("yes")) { - b = true; - } else { - b = Boolean.valueOf(s).booleanValue(); - } - } - return b; - } - - /** - * Returns the Class object associated with the class or - * interface with the given string name. - * - *

The Class object is determined by passing the given string - * name to the Class.forName() method, unless the given string - * name represents a primitive type, in which case it is converted to a - * Class object by appending ".class" to it (e.g., "int.class"). - */ - public static Class toClass(String type, ClassLoader loader) - throws ClassNotFoundException { - - Class c = null; - int i0 = type.indexOf('['); - int dims = 0; - if (i0 > 0) { - // This is an array. Count the dimensions - for (int i = 0; i < type.length(); i++) { - if (type.charAt(i) == '[') - dims++; - } - type = type.substring(0, i0); - } - - if ("boolean".equals(type)) - c = boolean.class; - else if ("char".equals(type)) - c = char.class; - else if ("byte".equals(type)) - c = byte.class; - else if ("short".equals(type)) - c = short.class; - else if ("int".equals(type)) - c = int.class; - else if ("long".equals(type)) - c = long.class; - else if ("float".equals(type)) - c = float.class; - else if ("double".equals(type)) - c = double.class; - else if (type.indexOf('[') < 0) - c = loader.loadClass(type); - - if (dims == 0) - return c; - - if (dims == 1) - return java.lang.reflect.Array.newInstance(c, 1).getClass(); - - // Array of more than i dimension - return java.lang.reflect.Array.newInstance(c, new int[dims]).getClass(); - } - - /** - * Produces a String representing a call to the EL interpreter. - * @param expression a String containing zero or more "${}" expressions - * @param expectedType the expected type of the interpreted result - * @param fnmapvar Variable pointing to a function map. - * @param XmlEscape True if the result should do XML escaping - * @return a String representing a call to the EL interpreter. - */ - public static String interpreterCall(boolean isTagFile, - String expression, - Class expectedType, - String fnmapvar, - boolean XmlEscape ) - { - /* - * Determine which context object to use. - */ - String jspCtxt = null; - if (isTagFile) - jspCtxt = "this.getJspContext()"; - else - jspCtxt = "_jspx_page_context"; - - /* - * Determine whether to use the expected type's textual name - * or, if it's a primitive, the name of its correspondent boxed - * type. - */ - String targetType = expectedType.getName(); - String primitiveConverterMethod = null; - if (expectedType.isPrimitive()) { - if (expectedType.equals(Boolean.TYPE)) { - targetType = Boolean.class.getName(); - primitiveConverterMethod = "booleanValue"; - } else if (expectedType.equals(Byte.TYPE)) { - targetType = Byte.class.getName(); - primitiveConverterMethod = "byteValue"; - } else if (expectedType.equals(Character.TYPE)) { - targetType = Character.class.getName(); - primitiveConverterMethod = "charValue"; - } else if (expectedType.equals(Short.TYPE)) { - targetType = Short.class.getName(); - primitiveConverterMethod = "shortValue"; - } else if (expectedType.equals(Integer.TYPE)) { - targetType = Integer.class.getName(); - primitiveConverterMethod = "intValue"; - } else if (expectedType.equals(Long.TYPE)) { - targetType = Long.class.getName(); - primitiveConverterMethod = "longValue"; - } else if (expectedType.equals(Float.TYPE)) { - targetType = Float.class.getName(); - primitiveConverterMethod = "floatValue"; - } else if (expectedType.equals(Double.TYPE)) { - targetType = Double.class.getName(); - primitiveConverterMethod = "doubleValue"; - } - } - - if (primitiveConverterMethod != null) { - XmlEscape = false; - } - - /* - * Build up the base call to the interpreter. - */ - // XXX - We use a proprietary call to the interpreter for now - // as the current standard machinery is inefficient and requires - // lots of wrappers and adapters. This should all clear up once - // the EL interpreter moves out of JSTL and into its own project. - // In the future, this should be replaced by code that calls - // ExpressionEvaluator.parseExpression() and then cache the resulting - // expression objects. The interpreterCall would simply select - // one of the pre-cached expressions and evaluate it. - // Note that PageContextImpl implements VariableResolver and - // the generated Servlet/SimpleTag implements FunctionMapper, so - // that machinery is already in place (mroth). - targetType = toJavaSourceType(targetType); - StringBuffer call = new StringBuffer( - "(" + targetType + ") " - + "org.apache.jasper.runtime.PageContextImpl.proprietaryEvaluate" - + "(" + Generator.quote(expression) + ", " - + targetType + ".class, " - + "(PageContext)" + jspCtxt - + ", " + fnmapvar - + ", " + XmlEscape - + ")"); - - /* - * Add the primitive converter method if we need to. - */ - if (primitiveConverterMethod != null) { - call.insert(0, "("); - call.append(")." + primitiveConverterMethod + "()"); - } - - return call.toString(); - } - - /** - * Validates the syntax of all ${} expressions within the given string. - * @param where the approximate location of the expressions in the JSP page - * @param expressions a string containing zero or more "${}" expressions - * @param err an error dispatcher to use - * @deprecated now delegated to the org.apache.el Package - */ - public static void validateExpressions(Mark where, - String expressions, - Class expectedType, - FunctionMapper functionMapper, - ErrorDispatcher err) - throws JasperException { - -// try { -// -// JspUtil.expressionEvaluator.parseExpression( expressions, -// expectedType, functionMapper ); -// } -// catch( ELParseException e ) { -// err.jspError(where, "jsp.error.invalid.expression", expressions, -// e.toString() ); -// } -// catch( ELException e ) { -// err.jspError(where, "jsp.error.invalid.expression", expressions, -// e.toString() ); -// } - } - - /** - * Resets the temporary variable name. - * (not thread-safe) - * @deprecated - */ - public static void resetTemporaryVariableName() { - tempSequenceNumber = 0; - } - - /** - * Generates a new temporary variable name. - * (not thread-safe) - * @deprecated - */ - public static String nextTemporaryVariableName() { - return Constants.TEMP_VARIABLE_NAME_PREFIX + (tempSequenceNumber++); - } - - public static String coerceToPrimitiveBoolean(String s, - boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToBoolean(" + s + ")"; - } else { - if (s == null || s.length() == 0) - return "false"; - else - return Boolean.valueOf(s).toString(); - } - } - - public static String coerceToBoolean(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Boolean) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Boolean.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Boolean(false)"; - } else { - // Detect format error at translation time - return "new Boolean(" + Boolean.valueOf(s).toString() + ")"; - } - } - } - - public static String coerceToPrimitiveByte(String s, - boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToByte(" + s + ")"; - } else { - if (s == null || s.length() == 0) - return "(byte) 0"; - else - return "((byte)" + Byte.valueOf(s).toString() + ")"; - } - } - - public static String coerceToByte(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Byte) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Byte.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Byte((byte) 0)"; - } else { - // Detect format error at translation time - return "new Byte((byte)" + Byte.valueOf(s).toString() + ")"; - } - } - } - - public static String coerceToChar(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToChar(" + s + ")"; - } else { - if (s == null || s.length() == 0) { - return "(char) 0"; - } else { - char ch = s.charAt(0); - // this trick avoids escaping issues - return "((char) " + (int) ch + ")"; - } - } - } - - public static String coerceToCharacter(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Character) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Character.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Character((char) 0)"; - } else { - char ch = s.charAt(0); - // this trick avoids escaping issues - return "new Character((char) " + (int) ch + ")"; - } - } - } - - public static String coerceToPrimitiveDouble(String s, - boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToDouble(" + s + ")"; - } else { - if (s == null || s.length() == 0) - return "(double) 0"; - else - return Double.valueOf(s).toString(); - } - } - - public static String coerceToDouble(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Double) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Double.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Double(0)"; - } else { - // Detect format error at translation time - return "new Double(" + Double.valueOf(s).toString() + ")"; - } - } - } - - public static String coerceToPrimitiveFloat(String s, - boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToFloat(" + s + ")"; - } else { - if (s == null || s.length() == 0) - return "(float) 0"; - else - return Float.valueOf(s).toString() + "f"; - } - } - - public static String coerceToFloat(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Float) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Float.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Float(0)"; - } else { - // Detect format error at translation time - return "new Float(" + Float.valueOf(s).toString() + "f)"; - } - } - } - - public static String coerceToInt(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToInt(" + s + ")"; - } else { - if (s == null || s.length() == 0) - return "0"; - else - return Integer.valueOf(s).toString(); - } - } - - public static String coerceToInteger(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Integer) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Integer.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Integer(0)"; - } else { - // Detect format error at translation time - return "new Integer(" + Integer.valueOf(s).toString() + ")"; - } - } - } - - public static String coerceToPrimitiveShort(String s, - boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToShort(" + s + ")"; - } else { - if (s == null || s.length() == 0) - return "(short) 0"; - else - return "((short) " + Short.valueOf(s).toString() + ")"; - } - } - - public static String coerceToShort(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Short) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Short.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Short((short) 0)"; - } else { - // Detect format error at translation time - return "new Short(\"" + Short.valueOf(s).toString() + "\")"; - } - } - } - - public static String coerceToPrimitiveLong(String s, - boolean isNamedAttribute) { - if (isNamedAttribute) { - return "org.apache.jasper.runtime.JspRuntimeLibrary.coerceToLong(" + s + ")"; - } else { - if (s == null || s.length() == 0) - return "(long) 0"; - else - return Long.valueOf(s).toString() + "l"; - } - } - - public static String coerceToLong(String s, boolean isNamedAttribute) { - if (isNamedAttribute) { - return "(Long) org.apache.jasper.runtime.JspRuntimeLibrary.coerce(" + s + ", Long.class)"; - } else { - if (s == null || s.length() == 0) { - return "new Long(0)"; - } else { - // Detect format error at translation time - return "new Long(" + Long.valueOf(s).toString() + "l)"; - } - } - } - - public static InputStream getInputStream(String fname, JarFile jarFile, - JspCompilationContext ctxt, - ErrorDispatcher err) - throws JasperException, IOException { - - InputStream in = null; - - if (jarFile != null) { - String jarEntryName = fname.substring(1, fname.length()); - ZipEntry jarEntry = jarFile.getEntry(jarEntryName); - if (jarEntry == null) { - err.jspError("jsp.error.file.not.found", fname); - } - in = jarFile.getInputStream(jarEntry); - } else { - in = ctxt.getResourceAsStream(fname); - } - - if (in == null) { - err.jspError("jsp.error.file.not.found", fname); - } - - return in; - } - - /** - * Gets the fully-qualified class name of the tag handler corresponding to - * the given tag file path. - * - * @param path Tag file path - * @param err Error dispatcher - * - * @return Fully-qualified class name of the tag handler corresponding to - * the given tag file path - * - * @deprecated Use {@link #getTagHandlerClassName(String, String, - * ErrorDispatcher) - * See https://issues.apache.org/bugzilla/show_bug.cgi?id=46471 - */ - public static String getTagHandlerClassName(String path, - ErrorDispatcher err) - throws JasperException { - return getTagHandlerClassName(path, null, err); - } - - /** - * Gets the fully-qualified class name of the tag handler corresponding to - * the given tag file path. - * - * @param path - * Tag file path - * @param err - * Error dispatcher - * - * @return Fully-qualified class name of the tag handler corresponding to - * the given tag file path - */ - public static String getTagHandlerClassName(String path, String urn, - ErrorDispatcher err) throws JasperException { - - String className = null; - int begin = 0; - int index; - - index = path.lastIndexOf(".tag"); - if (index == -1) { - err.jspError("jsp.error.tagfile.badSuffix", path); - } - - //It's tempting to remove the ".tag" suffix here, but we can't. - //If we remove it, the fully-qualified class name of this tag - //could conflict with the package name of other tags. - //For instance, the tag file - // /WEB-INF/tags/foo.tag - //would have fully-qualified class name - // org.apache.jsp.tag.web.foo - //which would conflict with the package name of the tag file - // /WEB-INF/tags/foo/bar.tag - - index = path.indexOf(WEB_INF_TAGS); - if (index != -1) { - className = "org.apache.jsp.tag.web."; - begin = index + WEB_INF_TAGS.length(); - } else { - index = path.indexOf(META_INF_TAGS); - if (index != -1) { - className = getClassNameBase(urn); - begin = index + META_INF_TAGS.length(); - } else { - err.jspError("jsp.error.tagfile.illegalPath", path); - } - } - - className += makeJavaPackage(path.substring(begin)); - - return className; - } - - private static String getClassNameBase(String urn) { - StringBuffer base = new StringBuffer("org.apache.jsp.tag.meta."); - if (urn != null) { - base.append(makeJavaPackage(urn)); - base.append('.'); - } - return base.toString(); - } - - /** - * Converts the given path to a Java package or fully-qualified class name - * - * @param path Path to convert - * - * @return Java package corresponding to the given path - */ - public static final String makeJavaPackage(String path) { - String classNameComponents[] = split(path,"/"); - StringBuffer legalClassNames = new StringBuffer(); - for (int i = 0; i < classNameComponents.length; i++) { - legalClassNames.append(makeJavaIdentifier(classNameComponents[i])); - if (i < classNameComponents.length - 1) { - legalClassNames.append('.'); - } - } - return legalClassNames.toString(); - } - - /** - * Splits a string into it's components. - * @param path String to split - * @param pat Pattern to split at - * @return the components of the path - */ - private static final String [] split(String path, String pat) { - Vector comps = new Vector(); - int pos = path.indexOf(pat); - int start = 0; - while( pos >= 0 ) { - if(pos > start ) { - String comp = path.substring(start,pos); - comps.add(comp); - } - start = pos + pat.length(); - pos = path.indexOf(pat,start); - } - if( start < path.length()) { - comps.add(path.substring(start)); - } - String [] result = new String[comps.size()]; - for(int i=0; i < comps.size(); i++) { - result[i] = (String)comps.elementAt(i); - } - return result; - } - - /** - * Converts the given identifier to a legal Java identifier - * - * @param identifier Identifier to convert - * - * @return Legal Java identifier corresponding to the given identifier - */ - public static final String makeJavaIdentifier(String identifier) { - StringBuffer modifiedIdentifier = - new StringBuffer(identifier.length()); - if (!Character.isJavaIdentifierStart(identifier.charAt(0))) { - modifiedIdentifier.append('_'); - } - for (int i = 0; i < identifier.length(); i++) { - char ch = identifier.charAt(i); - if (Character.isJavaIdentifierPart(ch) && ch != '_') { - modifiedIdentifier.append(ch); - } else if (ch == '.') { - modifiedIdentifier.append('_'); - } else { - modifiedIdentifier.append(mangleChar(ch)); - } - } - if (isJavaKeyword(modifiedIdentifier.toString())) { - modifiedIdentifier.append('_'); - } - return modifiedIdentifier.toString(); - } - - /** - * Mangle the specified character to create a legal Java class name. - */ - public static final String mangleChar(char ch) { - char[] result = new char[5]; - result[0] = '_'; - result[1] = Character.forDigit((ch >> 12) & 0xf, 16); - result[2] = Character.forDigit((ch >> 8) & 0xf, 16); - result[3] = Character.forDigit((ch >> 4) & 0xf, 16); - result[4] = Character.forDigit(ch & 0xf, 16); - return new String(result); - } - - /** - * Test whether the argument is a Java keyword - */ - public static boolean isJavaKeyword(String key) { - int i = 0; - int j = javaKeywords.length; - while (i < j) { - int k = (i+j)/2; - int result = javaKeywords[k].compareTo(key); - if (result == 0) { - return true; - } - if (result < 0) { - i = k+1; - } else { - j = k; - } - } - return false; - } - - /** - * Converts the given Xml name to a legal Java identifier. This is - * slightly more efficient than makeJavaIdentifier in that we only need - * to worry about '.', '-', and ':' in the string. We also assume that - * the resultant string is further concatenated with some prefix string - * so that we don't have to worry about it being a Java key word. - * - * @param name Identifier to convert - * - * @return Legal Java identifier corresponding to the given identifier - */ - public static final String makeXmlJavaIdentifier(String name) { - if (name.indexOf('-') >= 0) - name = replace(name, '-', "$1"); - if (name.indexOf('.') >= 0) - name = replace(name, '.', "$2"); - if (name.indexOf(':') >= 0) - name = replace(name, ':', "$3"); - return name; - } - - static InputStreamReader getReader(String fname, String encoding, - JarFile jarFile, - JspCompilationContext ctxt, - ErrorDispatcher err) - throws JasperException, IOException { - - return getReader(fname, encoding, jarFile, ctxt, err, 0); - } - - static InputStreamReader getReader(String fname, String encoding, - JarFile jarFile, - JspCompilationContext ctxt, - ErrorDispatcher err, int skip) - throws JasperException, IOException { - - InputStreamReader reader = null; - InputStream in = getInputStream(fname, jarFile, ctxt, err); - for (int i = 0; i < skip; i++) { - in.read(); - } - try { - reader = new InputStreamReader(in, encoding); - } catch (UnsupportedEncodingException ex) { - err.jspError("jsp.error.unsupported.encoding", encoding); - } - - return reader; - } - - /** - * Handles taking input from TLDs - * 'java.lang.Object' -> 'java.lang.Object.class' - * 'int' -> 'int.class' - * 'void' -> 'Void.TYPE' - * 'int[]' -> 'int[].class' - * - * @param type - * @return - */ - public static String toJavaSourceTypeFromTld(String type) { - if (type == null || "void".equals(type)) { - return "Void.TYPE"; - } - return type + ".class"; - } - - /** - * Class.getName() return arrays in the form "[[[", where et, - * the element type can be one of ZBCDFIJS or L; - * It is converted into forms that can be understood by javac. - */ - public static String toJavaSourceType(String type) { - - if (type.charAt(0) != '[') { - return type; - } - - int dims = 1; - String t = null; - for (int i = 1; i < type.length(); i++) { - if (type.charAt(i) == '[') { - dims++; - } else { - switch (type.charAt(i)) { - case 'Z': t = "boolean"; break; - case 'B': t = "byte"; break; - case 'C': t = "char"; break; - case 'D': t = "double"; break; - case 'F': t = "float"; break; - case 'I': t = "int"; break; - case 'J': t = "long"; break; - case 'S': t = "short"; break; - case 'L': t = type.substring(i+1, type.indexOf(';')); break; - } - break; - } - } - StringBuffer resultType = new StringBuffer(t); - for (; dims > 0; dims--) { - resultType.append("[]"); - } - return resultType.toString(); - } - - /** - * Compute the canonical name from a Class instance. Note that a - * simple replacment of '$' with '.' of a binary name would not work, - * as '$' is a legal Java Identifier character. - * @param c A instance of java.lang.Class - * @return The canonical name of c. - */ - public static String getCanonicalName(Class c) { - - String binaryName = c.getName(); - c = c.getDeclaringClass(); - - if (c == null) { - return binaryName; - } - - StringBuffer buf = new StringBuffer(binaryName); - do { - buf.setCharAt(c.getName().length(), '.'); - c = c.getDeclaringClass(); - } while ( c != null); - - return buf.toString(); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Localizer.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Localizer.java deleted file mode 100644 index 260ac51be..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Localizer.java +++ /dev/null @@ -1,160 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.text.MessageFormat; -import java.util.MissingResourceException; -import java.util.ResourceBundle; - -/** - * Class responsible for converting error codes to corresponding localized - * error messages. - * - * @author Jan Luehe - */ -public class Localizer { - - private static ResourceBundle bundle = null; - - static { - try { - bundle = ResourceBundle.getBundle( - "org.apache.jasper.resources.LocalStrings"); - } catch (Throwable t) { - t.printStackTrace(); - } - } - - /* - * Returns the localized error message corresponding to the given error - * code. - * - * If the given error code is not defined in the resource bundle for - * localized error messages, it is used as the error message. - * - * @param errCode Error code to localize - * - * @return Localized error message - */ - public static String getMessage(String errCode) { - String errMsg = errCode; - try { - errMsg = bundle.getString(errCode); - } catch (MissingResourceException e) { - } - return errMsg; - } - - /* - * Returns the localized error message corresponding to the given error - * code. - * - * If the given error code is not defined in the resource bundle for - * localized error messages, it is used as the error message. - * - * @param errCode Error code to localize - * @param arg Argument for parametric replacement - * - * @return Localized error message - */ - public static String getMessage(String errCode, String arg) { - return getMessage(errCode, new Object[] {arg}); - } - - /* - * Returns the localized error message corresponding to the given error - * code. - * - * If the given error code is not defined in the resource bundle for - * localized error messages, it is used as the error message. - * - * @param errCode Error code to localize - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - * - * @return Localized error message - */ - public static String getMessage(String errCode, String arg1, String arg2) { - return getMessage(errCode, new Object[] {arg1, arg2}); - } - - /* - * Returns the localized error message corresponding to the given error - * code. - * - * If the given error code is not defined in the resource bundle for - * localized error messages, it is used as the error message. - * - * @param errCode Error code to localize - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - * @param arg3 Third argument for parametric replacement - * - * @return Localized error message - */ - public static String getMessage(String errCode, String arg1, String arg2, - String arg3) { - return getMessage(errCode, new Object[] {arg1, arg2, arg3}); - } - - /* - * Returns the localized error message corresponding to the given error - * code. - * - * If the given error code is not defined in the resource bundle for - * localized error messages, it is used as the error message. - * - * @param errCode Error code to localize - * @param arg1 First argument for parametric replacement - * @param arg2 Second argument for parametric replacement - * @param arg3 Third argument for parametric replacement - * @param arg4 Fourth argument for parametric replacement - * - * @return Localized error message - */ - public static String getMessage(String errCode, String arg1, String arg2, - String arg3, String arg4) { - return getMessage(errCode, new Object[] {arg1, arg2, arg3, arg4}); - } - - /* - * Returns the localized error message corresponding to the given error - * code. - * - * If the given error code is not defined in the resource bundle for - * localized error messages, it is used as the error message. - * - * @param errCode Error code to localize - * @param args Arguments for parametric replacement - * - * @return Localized error message - */ - public static String getMessage(String errCode, Object[] args) { - String errMsg = errCode; - try { - errMsg = bundle.getString(errCode); - if (args != null) { - MessageFormat formatter = new MessageFormat(errMsg); - errMsg = formatter.format(args); - } - } catch (MissingResourceException e) { - } - - return errMsg; - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Mark.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Mark.java deleted file mode 100644 index 85c942bfe..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Mark.java +++ /dev/null @@ -1,282 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import java.util.Stack; -import java.net.URL; -import java.net.MalformedURLException; -import org.apache.jasper.JspCompilationContext; - -/** - * Mark represents a point in the JSP input. - * - * @author Anil K. Vijendran - */ -final class Mark { - - // position within current stream - int cursor, line, col; - - // directory of file for current stream - String baseDir; - - // current stream - char[] stream = null; - - // fileid of current stream - private int fileId; - - // name of the current file - private String fileName; - - /* - * stack of stream and stream state of streams that have included - * current stream - */ - private Stack includeStack = null; - - // encoding of current file - private String encoding = null; - - // reader that owns this mark (so we can look up fileid's) - private JspReader reader; - - private JspCompilationContext ctxt; - - /** - * Constructor - * - * @param reader JspReader this mark belongs to - * @param inStream current stream for this mark - * @param fileId id of requested jsp file - * @param name JSP file name - * @param inBaseDir base directory of requested jsp file - * @param inEncoding encoding of current file - */ - Mark(JspReader reader, char[] inStream, int fileId, String name, - String inBaseDir, String inEncoding) { - - this.reader = reader; - this.ctxt = reader.getJspCompilationContext(); - this.stream = inStream; - this.cursor = 0; - this.line = 1; - this.col = 1; - this.fileId = fileId; - this.fileName = name; - this.baseDir = inBaseDir; - this.encoding = inEncoding; - this.includeStack = new Stack(); - } - - - /** - * Constructor - */ - Mark(Mark other) { - - this.reader = other.reader; - this.ctxt = other.reader.getJspCompilationContext(); - this.stream = other.stream; - this.fileId = other.fileId; - this.fileName = other.fileName; - this.cursor = other.cursor; - this.line = other.line; - this.col = other.col; - this.baseDir = other.baseDir; - this.encoding = other.encoding; - - // clone includeStack without cloning contents - includeStack = new Stack(); - for ( int i=0; i < other.includeStack.size(); i++ ) { - includeStack.addElement( other.includeStack.elementAt(i) ); - } - } - - - /** - * Constructor - */ - Mark(JspCompilationContext ctxt, String filename, int line, int col) { - - this.reader = null; - this.ctxt = ctxt; - this.stream = null; - this.cursor = 0; - this.line = line; - this.col = col; - this.fileId = -1; - this.fileName = filename; - this.baseDir = "le-basedir"; - this.encoding = "le-endocing"; - this.includeStack = null; - } - - - /** - * Sets this mark's state to a new stream. - * It will store the current stream in it's includeStack. - * - * @param inStream new stream for mark - * @param inFileId id of new file from which stream comes from - * @param inBaseDir directory of file - * @param inEncoding encoding of new file - */ - public void pushStream(char[] inStream, int inFileId, String name, - String inBaseDir, String inEncoding) - { - // store current state in stack - includeStack.push(new IncludeState(cursor, line, col, fileId, - fileName, baseDir, - encoding, stream) ); - - // set new variables - cursor = 0; - line = 1; - col = 1; - fileId = inFileId; - fileName = name; - baseDir = inBaseDir; - encoding = inEncoding; - stream = inStream; - } - - - /** - * Restores this mark's state to a previously stored stream. - * @return The previous Mark instance when the stream was pushed, or null - * if there is no previous stream - */ - public Mark popStream() { - // make sure we have something to pop - if ( includeStack.size() <= 0 ) { - return null; - } - - // get previous state in stack - IncludeState state = (IncludeState) includeStack.pop( ); - - // set new variables - cursor = state.cursor; - line = state.line; - col = state.col; - fileId = state.fileId; - fileName = state.fileName; - baseDir = state.baseDir; - stream = state.stream; - return this; - } - - - // -------------------- Locator interface -------------------- - - public int getLineNumber() { - return line; - } - - public int getColumnNumber() { - return col; - } - - public String getSystemId() { - return getFile(); - } - - public String getPublicId() { - return null; - } - - public String toString() { - return getFile()+"("+line+","+col+")"; - } - - public String getFile() { - return this.fileName; - } - - /** - * Gets the URL of the resource with which this Mark is associated - * - * @return URL of the resource with which this Mark is associated - * - * @exception MalformedURLException if the resource pathname is incorrect - */ - public URL getURL() throws MalformedURLException { - return ctxt.getResource(getFile()); - } - - public String toShortString() { - return "("+line+","+col+")"; - } - - public boolean equals(Object other) { - if (other instanceof Mark) { - Mark m = (Mark) other; - return this.reader == m.reader && this.fileId == m.fileId - && this.cursor == m.cursor && this.line == m.line - && this.col == m.col; - } - return false; - } - - /** - * @return true if this Mark is greather than the other - * Mark, false otherwise. - */ - public boolean isGreater(Mark other) { - - boolean greater = false; - - if (this.line > other.line) { - greater = true; - } else if (this.line == other.line && this.col > other.col) { - greater = true; - } - - return greater; - } - - /** - * Keep track of parser before parsing an included file. - * This class keeps track of the parser before we switch to parsing an - * included file. In other words, it's the parser's continuation to be - * reinstalled after the included file parsing is done. - */ - class IncludeState { - int cursor, line, col; - int fileId; - String fileName; - String baseDir; - String encoding; - char[] stream = null; - - IncludeState(int inCursor, int inLine, int inCol, int inFileId, - String name, String inBaseDir, String inEncoding, - char[] inStream) { - cursor = inCursor; - line = inLine; - col = inCol; - fileId = inFileId; - fileName = name; - baseDir = inBaseDir; - encoding = inEncoding; - stream = inStream; - } - } - -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Node.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Node.java deleted file mode 100644 index 2aa504fdc..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Node.java +++ /dev/null @@ -1,2567 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.util.Iterator; -import java.util.List; -import java.util.Vector; -import java.util.ArrayList; - -import javax.el.ELContext; -import javax.el.ELException; -import javax.el.ExpressionFactory; -import javax.el.ValueExpression; -import javax.servlet.jsp.tagext.BodyTag; -import javax.servlet.jsp.tagext.DynamicAttributes; -import javax.servlet.jsp.tagext.IterationTag; -import javax.servlet.jsp.tagext.JspIdConsumer; -import javax.servlet.jsp.tagext.SimpleTag; -import javax.servlet.jsp.tagext.TagAttributeInfo; -import javax.servlet.jsp.tagext.TagData; -import javax.servlet.jsp.tagext.TagFileInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagVariableInfo; -import javax.servlet.jsp.tagext.TryCatchFinally; -import javax.servlet.jsp.tagext.VariableInfo; - -import org.apache.jasper.Constants; -import org.apache.jasper.JasperException; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; -import org.xml.sax.Attributes; - -/** - * An internal data representation of a JSP page or a JSP docuement (XML). Also - * included here is a visitor class for tranversing nodes. - * - * @author Kin-man Chung - * @author Jan Luehe - * @author Shawn Bayern - * @author Mark Roth - */ - -abstract class Node implements TagConstants { - - private static final VariableInfo[] ZERO_VARIABLE_INFO = {}; - - protected Attributes attrs; - - // xmlns attributes that represent tag libraries (only in XML syntax) - protected Attributes taglibAttrs; - - /* - * xmlns attributes that do not represent tag libraries (only in XML syntax) - */ - protected Attributes nonTaglibXmlnsAttrs; - - protected Nodes body; - - protected String text; - - protected Mark startMark; - - protected int beginJavaLine; - - protected int endJavaLine; - - protected Node parent; - - protected Nodes namedAttributeNodes; // cached for performance - - protected String qName; - - protected String localName; - - /* - * The name of the inner class to which the codes for this node and its body - * are generated. For instance, for in foo.jsp, this is - * "foo_jspHelper". This is primarily used for communicating such info from - * Generator to Smap generator. - */ - protected String innerClassName; - - private boolean isDummy; - - /** - * Zero-arg Constructor. - */ - public Node() { - this.isDummy = true; - } - - /** - * Constructor. - * - * @param start - * The location of the jsp page - * @param parent - * The enclosing node - */ - public Node(Mark start, Node parent) { - this.startMark = start; - this.isDummy = (start == null); - addToParent(parent); - } - - /** - * Constructor. - * - * @param qName - * The action's qualified name - * @param localName - * The action's local name - * @param start - * The location of the jsp page - * @param parent - * The enclosing node - */ - public Node(String qName, String localName, Mark start, Node parent) { - this.qName = qName; - this.localName = localName; - this.startMark = start; - this.isDummy = (start == null); - addToParent(parent); - } - - /** - * Constructor for Nodes parsed from standard syntax. - * - * @param qName - * The action's qualified name - * @param localName - * The action's local name - * @param attrs - * The attributes for this node - * @param start - * The location of the jsp page - * @param parent - * The enclosing node - */ - public Node(String qName, String localName, Attributes attrs, Mark start, - Node parent) { - this.qName = qName; - this.localName = localName; - this.attrs = attrs; - this.startMark = start; - this.isDummy = (start == null); - addToParent(parent); - } - - /** - * Constructor for Nodes parsed from XML syntax. - * - * @param qName - * The action's qualified name - * @param localName - * The action's local name - * @param attrs - * The action's attributes whose name does not start with xmlns - * @param nonTaglibXmlnsAttrs - * The action's xmlns attributes that do not represent tag - * libraries - * @param taglibAttrs - * The action's xmlns attributes that represent tag libraries - * @param start - * The location of the jsp page - * @param parent - * The enclosing node - */ - public Node(String qName, String localName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, Mark start, - Node parent) { - this.qName = qName; - this.localName = localName; - this.attrs = attrs; - this.nonTaglibXmlnsAttrs = nonTaglibXmlnsAttrs; - this.taglibAttrs = taglibAttrs; - this.startMark = start; - this.isDummy = (start == null); - addToParent(parent); - } - - /* - * Constructor. - * - * @param qName The action's qualified name @param localName The action's - * local name @param text The text associated with this node @param start - * The location of the jsp page @param parent The enclosing node - */ - public Node(String qName, String localName, String text, Mark start, - Node parent) { - this.qName = qName; - this.localName = localName; - this.text = text; - this.startMark = start; - this.isDummy = (start == null); - addToParent(parent); - } - - public String getQName() { - return this.qName; - } - - public String getLocalName() { - return this.localName; - } - - /* - * Gets this Node's attributes. - * - * In the case of a Node parsed from standard syntax, this method returns - * all the Node's attributes. - * - * In the case of a Node parsed from XML syntax, this method returns only - * those attributes whose name does not start with xmlns. - */ - public Attributes getAttributes() { - return this.attrs; - } - - /* - * Gets this Node's xmlns attributes that represent tag libraries (only - * meaningful for Nodes parsed from XML syntax) - */ - public Attributes getTaglibAttributes() { - return this.taglibAttrs; - } - - /* - * Gets this Node's xmlns attributes that do not represent tag libraries - * (only meaningful for Nodes parsed from XML syntax) - */ - public Attributes getNonTaglibXmlnsAttributes() { - return this.nonTaglibXmlnsAttrs; - } - - public void setAttributes(Attributes attrs) { - this.attrs = attrs; - } - - public String getAttributeValue(String name) { - return (attrs == null) ? null : attrs.getValue(name); - } - - /** - * Get the attribute that is non request time expression, either from the - * attribute of the node, or from a jsp:attrbute - */ - public String getTextAttribute(String name) { - - String attr = getAttributeValue(name); - if (attr != null) { - return attr; - } - - NamedAttribute namedAttribute = getNamedAttributeNode(name); - if (namedAttribute == null) { - return null; - } - - return namedAttribute.getText(); - } - - /** - * Searches all subnodes of this node for jsp:attribute standard actions - * with the given name, and returns the NamedAttribute node of the matching - * named attribute, nor null if no such node is found. - *

- * This should always be called and only be called for nodes that accept - * dynamic runtime attribute expressions. - */ - public NamedAttribute getNamedAttributeNode(String name) { - NamedAttribute result = null; - - // Look for the attribute in NamedAttribute children - Nodes nodes = getNamedAttributeNodes(); - int numChildNodes = nodes.size(); - for (int i = 0; i < numChildNodes; i++) { - NamedAttribute na = (NamedAttribute) nodes.getNode(i); - boolean found = false; - int index = name.indexOf(':'); - if (index != -1) { - // qualified name - found = na.getName().equals(name); - } else { - found = na.getLocalName().equals(name); - } - if (found) { - result = na; - break; - } - } - - return result; - } - - /** - * Searches all subnodes of this node for jsp:attribute standard actions, - * and returns that set of nodes as a Node.Nodes object. - * - * @return Possibly empty Node.Nodes object containing any jsp:attribute - * subnodes of this Node - */ - public Node.Nodes getNamedAttributeNodes() { - - if (namedAttributeNodes != null) { - return namedAttributeNodes; - } - - Node.Nodes result = new Node.Nodes(); - - // Look for the attribute in NamedAttribute children - Nodes nodes = getBody(); - if (nodes != null) { - int numChildNodes = nodes.size(); - for (int i = 0; i < numChildNodes; i++) { - Node n = nodes.getNode(i); - if (n instanceof NamedAttribute) { - result.add(n); - } else if (!(n instanceof Comment)) { - // Nothing can come before jsp:attribute, and only - // jsp:body can come after it. - break; - } - } - } - - namedAttributeNodes = result; - return result; - } - - public Nodes getBody() { - return body; - } - - public void setBody(Nodes body) { - this.body = body; - } - - public String getText() { - return text; - } - - public Mark getStart() { - return startMark; - } - - public Node getParent() { - return parent; - } - - public int getBeginJavaLine() { - return beginJavaLine; - } - - public void setBeginJavaLine(int begin) { - beginJavaLine = begin; - } - - public int getEndJavaLine() { - return endJavaLine; - } - - public void setEndJavaLine(int end) { - endJavaLine = end; - } - - public boolean isDummy() { - return isDummy; - } - - public Node.Root getRoot() { - Node n = this; - while (!(n instanceof Node.Root)) { - n = n.getParent(); - } - return (Node.Root) n; - } - - public String getInnerClassName() { - return innerClassName; - } - - public void setInnerClassName(String icn) { - innerClassName = icn; - } - - /** - * Selects and invokes a method in the visitor class based on the node type. - * This is abstract and should be overrode by the extending classes. - * - * @param v - * The visitor class - */ - abstract void accept(Visitor v) throws JasperException; - - // ********************************************************************* - // Private utility methods - - /* - * Adds this Node to the body of the given parent. - */ - private void addToParent(Node parent) { - if (parent != null) { - this.parent = parent; - Nodes parentBody = parent.getBody(); - if (parentBody == null) { - parentBody = new Nodes(); - parent.setBody(parentBody); - } - parentBody.add(this); - } - } - - /*************************************************************************** - * Child classes - */ - - /** - * Represents the root of a Jsp page or Jsp document - */ - public static class Root extends Node { - - private Root parentRoot; - - private boolean isXmlSyntax; - - // Source encoding of the page containing this Root - private String pageEnc; - - // Page encoding specified in JSP config element - private String jspConfigPageEnc; - - /* - * Flag indicating if the default page encoding is being used (only - * applicable with standard syntax). - * - * True if the page does not provide a page directive with a - * 'contentType' attribute (or the 'contentType' attribute doesn't have - * a CHARSET value), the page does not provide a page directive with a - * 'pageEncoding' attribute, and there is no JSP configuration element - * page-encoding whose URL pattern matches the page. - */ - private boolean isDefaultPageEncoding; - - /* - * Indicates whether an encoding has been explicitly specified in the - * page's XML prolog (only used for pages in XML syntax). This - * information is used to decide whether a translation error must be - * reported for encoding conflicts. - */ - private boolean isEncodingSpecifiedInProlog; - - /* - * Indicates whether an encoding has been explicitly specified in the - * page's bom. - */ - private boolean isBomPresent; - - /* - * Sequence number for temporary variables. - */ - private int tempSequenceNumber = 0; - - /* - * Constructor. - */ - Root(Mark start, Node parent, boolean isXmlSyntax) { - super(start, parent); - this.isXmlSyntax = isXmlSyntax; - this.qName = JSP_ROOT_ACTION; - this.localName = ROOT_ACTION; - - // Figure out and set the parent root - Node r = parent; - while ((r != null) && !(r instanceof Node.Root)) - r = r.getParent(); - parentRoot = (Node.Root) r; - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public boolean isXmlSyntax() { - return isXmlSyntax; - } - - /* - * Sets the encoding specified in the JSP config element whose URL - * pattern matches the page containing this Root. - */ - public void setJspConfigPageEncoding(String enc) { - jspConfigPageEnc = enc; - } - - /* - * Gets the encoding specified in the JSP config element whose URL - * pattern matches the page containing this Root. - */ - public String getJspConfigPageEncoding() { - return jspConfigPageEnc; - } - - public void setPageEncoding(String enc) { - pageEnc = enc; - } - - public String getPageEncoding() { - return pageEnc; - } - - public void setIsDefaultPageEncoding(boolean isDefault) { - isDefaultPageEncoding = isDefault; - } - - public boolean isDefaultPageEncoding() { - return isDefaultPageEncoding; - } - - public void setIsEncodingSpecifiedInProlog(boolean isSpecified) { - isEncodingSpecifiedInProlog = isSpecified; - } - - public boolean isEncodingSpecifiedInProlog() { - return isEncodingSpecifiedInProlog; - } - - public void setIsBomPresent(boolean isBom) { - isBomPresent = isBom; - } - - public boolean isBomPresent() { - return isBomPresent; - } - - /** - * @return The enclosing root to this Root. Usually represents the page - * that includes this one. - */ - public Root getParentRoot() { - return parentRoot; - } - - /** - * Generates a new temporary variable name. - */ - public String nextTemporaryVariableName() { - if (parentRoot == null) { - return Constants.TEMP_VARIABLE_NAME_PREFIX + (tempSequenceNumber++); - } else { - return parentRoot.nextTemporaryVariableName(); - } - - } - } - - /** - * Represents the root of a Jsp document (XML syntax) - */ - public static class JspRoot extends Node { - - public JspRoot(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, ROOT_ACTION, attrs, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a page directive - */ - public static class PageDirective extends Node { - - private Vector imports; - - public PageDirective(Attributes attrs, Mark start, Node parent) { - this(JSP_PAGE_DIRECTIVE_ACTION, attrs, null, null, start, parent); - } - - public PageDirective(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, PAGE_DIRECTIVE_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - imports = new Vector(); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - /** - * Parses the comma-separated list of class or package names in the - * given attribute value and adds each component to this PageDirective's - * vector of imported classes and packages. - * - * @param value - * A comma-separated string of imports. - */ - public void addImport(String value) { - int start = 0; - int index; - while ((index = value.indexOf(',', start)) != -1) { - imports.add(value.substring(start, index).trim()); - start = index + 1; - } - if (start == 0) { - // No comma found - imports.add(value.trim()); - } else { - imports.add(value.substring(start).trim()); - } - } - - public List getImports() { - return imports; - } - } - - /** - * Represents an include directive - */ - public static class IncludeDirective extends Node { - - public IncludeDirective(Attributes attrs, Mark start, Node parent) { - this(JSP_INCLUDE_DIRECTIVE_ACTION, attrs, null, null, start, parent); - } - - public IncludeDirective(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, INCLUDE_DIRECTIVE_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a custom taglib directive - */ - public static class TaglibDirective extends Node { - - public TaglibDirective(Attributes attrs, Mark start, Node parent) { - super(JSP_TAGLIB_DIRECTIVE_ACTION, TAGLIB_DIRECTIVE_ACTION, attrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a tag directive - */ - public static class TagDirective extends Node { - private Vector imports; - - public TagDirective(Attributes attrs, Mark start, Node parent) { - this(JSP_TAG_DIRECTIVE_ACTION, attrs, null, null, start, parent); - } - - public TagDirective(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, TAG_DIRECTIVE_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - imports = new Vector(); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - /** - * Parses the comma-separated list of class or package names in the - * given attribute value and adds each component to this PageDirective's - * vector of imported classes and packages. - * - * @param value - * A comma-separated string of imports. - */ - public void addImport(String value) { - int start = 0; - int index; - while ((index = value.indexOf(',', start)) != -1) { - imports.add(value.substring(start, index).trim()); - start = index + 1; - } - if (start == 0) { - // No comma found - imports.add(value.trim()); - } else { - imports.add(value.substring(start).trim()); - } - } - - public List getImports() { - return imports; - } - } - - /** - * Represents an attribute directive - */ - public static class AttributeDirective extends Node { - - public AttributeDirective(Attributes attrs, Mark start, Node parent) { - this(JSP_ATTRIBUTE_DIRECTIVE_ACTION, attrs, null, null, start, - parent); - } - - public AttributeDirective(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, ATTRIBUTE_DIRECTIVE_ACTION, attrs, - nonTaglibXmlnsAttrs, taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a variable directive - */ - public static class VariableDirective extends Node { - - public VariableDirective(Attributes attrs, Mark start, Node parent) { - this(JSP_VARIABLE_DIRECTIVE_ACTION, attrs, null, null, start, - parent); - } - - public VariableDirective(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, VARIABLE_DIRECTIVE_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a tag file action - */ - public static class InvokeAction extends Node { - - public InvokeAction(Attributes attrs, Mark start, Node parent) { - this(JSP_INVOKE_ACTION, attrs, null, null, start, parent); - } - - public InvokeAction(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, INVOKE_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a tag file action - */ - public static class DoBodyAction extends Node { - - public DoBodyAction(Attributes attrs, Mark start, Node parent) { - this(JSP_DOBODY_ACTION, attrs, null, null, start, parent); - } - - public DoBodyAction(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, DOBODY_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a Jsp comment Comments are kept for completeness. - */ - public static class Comment extends Node { - - public Comment(String text, Mark start, Node parent) { - super(null, null, text, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents an expression, declaration, or scriptlet - */ - public static abstract class ScriptingElement extends Node { - - public ScriptingElement(String qName, String localName, String text, - Mark start, Node parent) { - super(qName, localName, text, start, parent); - } - - public ScriptingElement(String qName, String localName, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, localName, null, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - /** - * When this node was created from a JSP page in JSP syntax, its text - * was stored as a String in the "text" field, whereas when this node - * was created from a JSP document, its text was stored as one or more - * TemplateText nodes in its body. This method handles either case. - * - * @return The text string - */ - public String getText() { - String ret = text; - if (ret == null) { - if (body != null) { - StringBuffer buf = new StringBuffer(); - for (int i = 0; i < body.size(); i++) { - buf.append(body.getNode(i).getText()); - } - ret = buf.toString(); - } else { - // Nulls cause NPEs further down the line - ret = ""; - } - } - return ret; - } - - /** - * For the same reason as above, the source line information in the - * contained TemplateText node should be used. - */ - public Mark getStart() { - if (text == null && body != null && body.size() > 0) { - return body.getNode(0).getStart(); - } else { - return super.getStart(); - } - } - } - - /** - * Represents a declaration - */ - public static class Declaration extends ScriptingElement { - - public Declaration(String text, Mark start, Node parent) { - super(JSP_DECLARATION_ACTION, DECLARATION_ACTION, text, start, - parent); - } - - public Declaration(String qName, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, DECLARATION_ACTION, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents an expression. Expressions in attributes are embedded in the - * attribute string and not here. - */ - public static class Expression extends ScriptingElement { - - public Expression(String text, Mark start, Node parent) { - super(JSP_EXPRESSION_ACTION, EXPRESSION_ACTION, text, start, parent); - } - - public Expression(String qName, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, EXPRESSION_ACTION, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a scriptlet - */ - public static class Scriptlet extends ScriptingElement { - - public Scriptlet(String text, Mark start, Node parent) { - super(JSP_SCRIPTLET_ACTION, SCRIPTLET_ACTION, text, start, parent); - } - - public Scriptlet(String qName, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, SCRIPTLET_ACTION, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents an EL expression. Expressions in attributes are embedded in - * the attribute string and not here. - */ - public static class ELExpression extends Node { - - private ELNode.Nodes el; - - private final char type; - - public ELExpression(char type, String text, Mark start, Node parent) { - super(null, null, text, start, parent); - this.type = type; - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setEL(ELNode.Nodes el) { - this.el = el; - } - - public ELNode.Nodes getEL() { - return el; - } - - public char getType() { - return this.type; - } - } - - /** - * Represents a param action - */ - public static class ParamAction extends Node { - - JspAttribute value; - - public ParamAction(Attributes attrs, Mark start, Node parent) { - this(JSP_PARAM_ACTION, attrs, null, null, start, parent); - } - - public ParamAction(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, PARAM_ACTION, attrs, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setValue(JspAttribute value) { - this.value = value; - } - - public JspAttribute getValue() { - return value; - } - } - - /** - * Represents a params action - */ - public static class ParamsAction extends Node { - - public ParamsAction(Mark start, Node parent) { - this(JSP_PARAMS_ACTION, null, null, start, parent); - } - - public ParamsAction(String qName, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, PARAMS_ACTION, null, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a fallback action - */ - public static class FallBackAction extends Node { - - public FallBackAction(Mark start, Node parent) { - this(JSP_FALLBACK_ACTION, null, null, start, parent); - } - - public FallBackAction(String qName, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, FALLBACK_ACTION, null, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents an include action - */ - public static class IncludeAction extends Node { - - private JspAttribute page; - - public IncludeAction(Attributes attrs, Mark start, Node parent) { - this(JSP_INCLUDE_ACTION, attrs, null, null, start, parent); - } - - public IncludeAction(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, INCLUDE_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setPage(JspAttribute page) { - this.page = page; - } - - public JspAttribute getPage() { - return page; - } - } - - /** - * Represents a forward action - */ - public static class ForwardAction extends Node { - - private JspAttribute page; - - public ForwardAction(Attributes attrs, Mark start, Node parent) { - this(JSP_FORWARD_ACTION, attrs, null, null, start, parent); - } - - public ForwardAction(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, FORWARD_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setPage(JspAttribute page) { - this.page = page; - } - - public JspAttribute getPage() { - return page; - } - } - - /** - * Represents a getProperty action - */ - public static class GetProperty extends Node { - - public GetProperty(Attributes attrs, Mark start, Node parent) { - this(JSP_GET_PROPERTY_ACTION, attrs, null, null, start, parent); - } - - public GetProperty(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, GET_PROPERTY_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a setProperty action - */ - public static class SetProperty extends Node { - - private JspAttribute value; - - public SetProperty(Attributes attrs, Mark start, Node parent) { - this(JSP_SET_PROPERTY_ACTION, attrs, null, null, start, parent); - } - - public SetProperty(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, SET_PROPERTY_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setValue(JspAttribute value) { - this.value = value; - } - - public JspAttribute getValue() { - return value; - } - } - - /** - * Represents a useBean action - */ - public static class UseBean extends Node { - - JspAttribute beanName; - - public UseBean(Attributes attrs, Mark start, Node parent) { - this(JSP_USE_BEAN_ACTION, attrs, null, null, start, parent); - } - - public UseBean(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, USE_BEAN_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setBeanName(JspAttribute beanName) { - this.beanName = beanName; - } - - public JspAttribute getBeanName() { - return beanName; - } - } - - /** - * Represents a plugin action - */ - public static class PlugIn extends Node { - - private JspAttribute width; - - private JspAttribute height; - - public PlugIn(Attributes attrs, Mark start, Node parent) { - this(JSP_PLUGIN_ACTION, attrs, null, null, start, parent); - } - - public PlugIn(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, PLUGIN_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setHeight(JspAttribute height) { - this.height = height; - } - - public void setWidth(JspAttribute width) { - this.width = width; - } - - public JspAttribute getHeight() { - return height; - } - - public JspAttribute getWidth() { - return width; - } - } - - /** - * Represents an uninterpreted tag, from a Jsp document - */ - public static class UninterpretedTag extends Node { - - private JspAttribute[] jspAttrs; - - public UninterpretedTag(String qName, String localName, - Attributes attrs, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, localName, attrs, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setJspAttributes(JspAttribute[] jspAttrs) { - this.jspAttrs = jspAttrs; - } - - public JspAttribute[] getJspAttributes() { - return jspAttrs; - } - } - - /** - * Represents a . - */ - public static class JspElement extends Node { - - private JspAttribute[] jspAttrs; - - private JspAttribute nameAttr; - - public JspElement(Attributes attrs, Mark start, Node parent) { - this(JSP_ELEMENT_ACTION, attrs, null, null, start, parent); - } - - public JspElement(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, ELEMENT_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public void setJspAttributes(JspAttribute[] jspAttrs) { - this.jspAttrs = jspAttrs; - } - - public JspAttribute[] getJspAttributes() { - return jspAttrs; - } - - /* - * Sets the XML-style 'name' attribute - */ - public void setNameAttribute(JspAttribute nameAttr) { - this.nameAttr = nameAttr; - } - - /* - * Gets the XML-style 'name' attribute - */ - public JspAttribute getNameAttribute() { - return this.nameAttr; - } - } - - /** - * Represents a . - */ - public static class JspOutput extends Node { - - public JspOutput(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - super(qName, OUTPUT_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Collected information about child elements. Used by nodes like CustomTag, - * JspBody, and NamedAttribute. The information is set in the Collector. - */ - public static class ChildInfo { - private boolean scriptless; // true if the tag and its body - - // contain no scripting elements. - private boolean hasUseBean; - - private boolean hasIncludeAction; - - private boolean hasParamAction; - - private boolean hasSetProperty; - - private boolean hasScriptingVars; - - public void setScriptless(boolean s) { - scriptless = s; - } - - public boolean isScriptless() { - return scriptless; - } - - public void setHasUseBean(boolean u) { - hasUseBean = u; - } - - public boolean hasUseBean() { - return hasUseBean; - } - - public void setHasIncludeAction(boolean i) { - hasIncludeAction = i; - } - - public boolean hasIncludeAction() { - return hasIncludeAction; - } - - public void setHasParamAction(boolean i) { - hasParamAction = i; - } - - public boolean hasParamAction() { - return hasParamAction; - } - - public void setHasSetProperty(boolean s) { - hasSetProperty = s; - } - - public boolean hasSetProperty() { - return hasSetProperty; - } - - public void setHasScriptingVars(boolean s) { - hasScriptingVars = s; - } - - public boolean hasScriptingVars() { - return hasScriptingVars; - } - } - - /** - * Represents a custom tag - */ - public static class CustomTag extends Node { - - private String uri; - - private String prefix; - - private JspAttribute[] jspAttrs; - - private TagData tagData; - - private String tagHandlerPoolName; - - private TagInfo tagInfo; - - private TagFileInfo tagFileInfo; - - private Class tagHandlerClass; - - private VariableInfo[] varInfos; - - private int customNestingLevel; - - private ChildInfo childInfo; - - private boolean implementsIterationTag; - - private boolean implementsBodyTag; - - private boolean implementsTryCatchFinally; - - private boolean implementsJspIdConsumer; - - private boolean implementsSimpleTag; - - private boolean implementsDynamicAttributes; - - private Vector atBeginScriptingVars; - - private Vector atEndScriptingVars; - - private Vector nestedScriptingVars; - - private Node.CustomTag customTagParent; - - private Integer numCount; - - private boolean useTagPlugin; - - private TagPluginContext tagPluginContext; - - /** - * The following two fields are used for holding the Java scriptlets - * that the tag plugins may generate. Meaningful only if useTagPlugin is - * true; Could move them into TagPluginContextImpl, but we'll need to - * cast tagPluginContext to TagPluginContextImpl all the time... - */ - private Nodes atSTag; - - private Nodes atETag; - - /* - * Constructor for custom action implemented by tag handler. - */ - public CustomTag(String qName, String prefix, String localName, - String uri, Attributes attrs, Mark start, Node parent, - TagInfo tagInfo, Class tagHandlerClass) { - this(qName, prefix, localName, uri, attrs, null, null, start, - parent, tagInfo, tagHandlerClass); - } - - /* - * Constructor for custom action implemented by tag handler. - */ - public CustomTag(String qName, String prefix, String localName, - String uri, Attributes attrs, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent, - TagInfo tagInfo, Class tagHandlerClass) { - super(qName, localName, attrs, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - - this.uri = uri; - this.prefix = prefix; - this.tagInfo = tagInfo; - this.tagHandlerClass = tagHandlerClass; - this.customNestingLevel = makeCustomNestingLevel(); - this.childInfo = new ChildInfo(); - - this.implementsIterationTag = IterationTag.class - .isAssignableFrom(tagHandlerClass); - this.implementsBodyTag = BodyTag.class - .isAssignableFrom(tagHandlerClass); - this.implementsTryCatchFinally = TryCatchFinally.class - .isAssignableFrom(tagHandlerClass); - this.implementsSimpleTag = SimpleTag.class - .isAssignableFrom(tagHandlerClass); - this.implementsDynamicAttributes = DynamicAttributes.class - .isAssignableFrom(tagHandlerClass); - this.implementsJspIdConsumer = JspIdConsumer.class - .isAssignableFrom(tagHandlerClass); - } - - /* - * Constructor for custom action implemented by tag file. - */ - public CustomTag(String qName, String prefix, String localName, - String uri, Attributes attrs, Mark start, Node parent, - TagFileInfo tagFileInfo) { - this(qName, prefix, localName, uri, attrs, null, null, start, - parent, tagFileInfo); - } - - /* - * Constructor for custom action implemented by tag file. - */ - public CustomTag(String qName, String prefix, String localName, - String uri, Attributes attrs, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent, - TagFileInfo tagFileInfo) { - - super(qName, localName, attrs, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - - this.uri = uri; - this.prefix = prefix; - this.tagFileInfo = tagFileInfo; - this.tagInfo = tagFileInfo.getTagInfo(); - this.customNestingLevel = makeCustomNestingLevel(); - this.childInfo = new ChildInfo(); - - this.implementsIterationTag = false; - this.implementsBodyTag = false; - this.implementsTryCatchFinally = false; - this.implementsSimpleTag = true; - this.implementsJspIdConsumer = false; - this.implementsDynamicAttributes = tagInfo.hasDynamicAttributes(); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - /** - * @return The URI namespace that this custom action belongs to - */ - public String getURI() { - return this.uri; - } - - /** - * @return The tag prefix - */ - public String getPrefix() { - return prefix; - } - - public void setJspAttributes(JspAttribute[] jspAttrs) { - this.jspAttrs = jspAttrs; - } - - public TagAttributeInfo getTagAttributeInfo(String name) { - TagInfo info = this.getTagInfo(); - if (info == null) - return null; - TagAttributeInfo[] tai = info.getAttributes(); - for (int i = 0; i < tai.length; i++) { - if (tai[i].getName().equals(name)) { - return tai[i]; - } - } - return null; - } - - public JspAttribute[] getJspAttributes() { - return jspAttrs; - } - - public ChildInfo getChildInfo() { - return childInfo; - } - - public void setTagData(TagData tagData) { - this.tagData = tagData; - this.varInfos = tagInfo.getVariableInfo(tagData); - if (this.varInfos == null) { - this.varInfos = ZERO_VARIABLE_INFO; - } - } - - public TagData getTagData() { - return tagData; - } - - public void setTagHandlerPoolName(String s) { - tagHandlerPoolName = s; - } - - public String getTagHandlerPoolName() { - return tagHandlerPoolName; - } - - public TagInfo getTagInfo() { - return tagInfo; - } - - public TagFileInfo getTagFileInfo() { - return tagFileInfo; - } - - /* - * @return true if this custom action is supported by a tag file, false - * otherwise - */ - public boolean isTagFile() { - return tagFileInfo != null; - } - - public Class getTagHandlerClass() { - return tagHandlerClass; - } - - public void setTagHandlerClass(Class hc) { - tagHandlerClass = hc; - } - - public boolean implementsIterationTag() { - return implementsIterationTag; - } - - public boolean implementsBodyTag() { - return implementsBodyTag; - } - - public boolean implementsTryCatchFinally() { - return implementsTryCatchFinally; - } - - public boolean implementsJspIdConsumer() { - return implementsJspIdConsumer; - } - - public boolean implementsSimpleTag() { - return implementsSimpleTag; - } - - public boolean implementsDynamicAttributes() { - return implementsDynamicAttributes; - } - - public TagVariableInfo[] getTagVariableInfos() { - return tagInfo.getTagVariableInfos(); - } - - public VariableInfo[] getVariableInfos() { - return varInfos; - } - - public void setCustomTagParent(Node.CustomTag n) { - this.customTagParent = n; - } - - public Node.CustomTag getCustomTagParent() { - return this.customTagParent; - } - - public void setNumCount(Integer count) { - this.numCount = count; - } - - public Integer getNumCount() { - return this.numCount; - } - - public void setScriptingVars(Vector vec, int scope) { - switch (scope) { - case VariableInfo.AT_BEGIN: - this.atBeginScriptingVars = vec; - break; - case VariableInfo.AT_END: - this.atEndScriptingVars = vec; - break; - case VariableInfo.NESTED: - this.nestedScriptingVars = vec; - break; - } - } - - /* - * Gets the scripting variables for the given scope that need to be - * declared. - */ - public Vector getScriptingVars(int scope) { - Vector vec = null; - - switch (scope) { - case VariableInfo.AT_BEGIN: - vec = this.atBeginScriptingVars; - break; - case VariableInfo.AT_END: - vec = this.atEndScriptingVars; - break; - case VariableInfo.NESTED: - vec = this.nestedScriptingVars; - break; - } - - return vec; - } - - /* - * Gets this custom tag's custom nesting level, which is given as the - * number of times this custom tag is nested inside itself. - */ - public int getCustomNestingLevel() { - return customNestingLevel; - } - - /** - * Checks to see if the attribute of the given name is of type - * JspFragment. - */ - public boolean checkIfAttributeIsJspFragment(String name) { - boolean result = false; - - TagAttributeInfo[] attributes = tagInfo.getAttributes(); - for (int i = 0; i < attributes.length; i++) { - if (attributes[i].getName().equals(name) - && attributes[i].isFragment()) { - result = true; - break; - } - } - - return result; - } - - public void setUseTagPlugin(boolean use) { - useTagPlugin = use; - } - - public boolean useTagPlugin() { - return useTagPlugin; - } - - public void setTagPluginContext(TagPluginContext tagPluginContext) { - this.tagPluginContext = tagPluginContext; - } - - public TagPluginContext getTagPluginContext() { - return tagPluginContext; - } - - public void setAtSTag(Nodes sTag) { - atSTag = sTag; - } - - public Nodes getAtSTag() { - return atSTag; - } - - public void setAtETag(Nodes eTag) { - atETag = eTag; - } - - public Nodes getAtETag() { - return atETag; - } - - /* - * Computes this custom tag's custom nesting level, which corresponds to - * the number of times this custom tag is nested inside itself. - * - * Example: - * - * -- nesting level 0 -- nesting level 1 - * -- nesting level 2 -- nesting level 1 - * - * - * @return Custom tag's nesting level - */ - private int makeCustomNestingLevel() { - int n = 0; - Node p = parent; - while (p != null) { - if ((p instanceof Node.CustomTag) - && qName.equals(((Node.CustomTag) p).qName)) { - n++; - } - p = p.parent; - } - return n; - } - - /** - * Returns true if this custom action has an empty body, and false - * otherwise. - * - * A custom action is considered to have an empty body if the following - * holds true: - getBody() returns null, or - all immediate children are - * jsp:attribute actions, or - the action's jsp:body is empty. - */ - public boolean hasEmptyBody() { - boolean hasEmptyBody = true; - Nodes nodes = getBody(); - if (nodes != null) { - int numChildNodes = nodes.size(); - for (int i = 0; i < numChildNodes; i++) { - Node n = nodes.getNode(i); - if (!(n instanceof NamedAttribute)) { - if (n instanceof JspBody) { - hasEmptyBody = (n.getBody() == null); - } else { - hasEmptyBody = false; - } - break; - } - } - } - - return hasEmptyBody; - } - } - - /** - * Used as a placeholder for the evaluation code of a custom action - * attribute (used by the tag plugin machinery only). - */ - public static class AttributeGenerator extends Node { - String name; // name of the attribute - - CustomTag tag; // The tag this attribute belongs to - - public AttributeGenerator(Mark start, String name, CustomTag tag) { - super(start, null); - this.name = name; - this.tag = tag; - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public String getName() { - return name; - } - - public CustomTag getTag() { - return tag; - } - } - - /** - * Represents the body of a <jsp:text> element - */ - public static class JspText extends Node { - - public JspText(String qName, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, TEXT_ACTION, null, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - } - - /** - * Represents a Named Attribute (<jsp:attribute>) - */ - public static class NamedAttribute extends Node { - - // A unique temporary variable name suitable for code generation - private String temporaryVariableName; - - // True if this node is to be trimmed, or false otherwise - private boolean trim = true; - - private ChildInfo childInfo; - - private String name; - - private String localName; - - private String prefix; - - public NamedAttribute(Attributes attrs, Mark start, Node parent) { - this(JSP_ATTRIBUTE_ACTION, attrs, null, null, start, parent); - } - - public NamedAttribute(String qName, Attributes attrs, - Attributes nonTaglibXmlnsAttrs, Attributes taglibAttrs, - Mark start, Node parent) { - - super(qName, ATTRIBUTE_ACTION, attrs, nonTaglibXmlnsAttrs, - taglibAttrs, start, parent); - if ("false".equals(this.getAttributeValue("trim"))) { - // (if null or true, leave default of true) - trim = false; - } - childInfo = new ChildInfo(); - name = this.getAttributeValue("name"); - if (name != null) { - // Mandatary attribute "name" will be checked in Validator - localName = name; - int index = name.indexOf(':'); - if (index != -1) { - prefix = name.substring(0, index); - localName = name.substring(index + 1); - } - } - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public String getName() { - return this.name; - } - - public String getLocalName() { - return this.localName; - } - - public String getPrefix() { - return this.prefix; - } - - public ChildInfo getChildInfo() { - return this.childInfo; - } - - public boolean isTrim() { - return trim; - } - - /** - * @return A unique temporary variable name to store the result in. - * (this probably could go elsewhere, but it's convenient here) - */ - public String getTemporaryVariableName() { - if (temporaryVariableName == null) { - temporaryVariableName = getRoot().nextTemporaryVariableName(); - } - return temporaryVariableName; - } - - /* - * Get the attribute value from this named attribute (). - * Since this method is only for attributes that are not rtexpr, we can - * assume the body of the jsp:attribute is a template text. - */ - public String getText() { - - class AttributeVisitor extends Visitor { - String attrValue = null; - - public void visit(TemplateText txt) { - attrValue = new String(txt.getText()); - } - - public String getAttrValue() { - return attrValue; - } - } - - // According to JSP 2.0, if the body of the - // action is empty, it is equivalent of specifying "" as the value - // of the attribute. - String text = ""; - if (getBody() != null) { - AttributeVisitor attributeVisitor = new AttributeVisitor(); - try { - getBody().visit(attributeVisitor); - } catch (JasperException e) { - } - text = attributeVisitor.getAttrValue(); - } - - return text; - } - } - - /** - * Represents a JspBody node (<jsp:body>) - */ - public static class JspBody extends Node { - - private ChildInfo childInfo; - - public JspBody(Mark start, Node parent) { - this(JSP_BODY_ACTION, null, null, start, parent); - } - - public JspBody(String qName, Attributes nonTaglibXmlnsAttrs, - Attributes taglibAttrs, Mark start, Node parent) { - super(qName, BODY_ACTION, null, nonTaglibXmlnsAttrs, taglibAttrs, - start, parent); - this.childInfo = new ChildInfo(); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - public ChildInfo getChildInfo() { - return childInfo; - } - } - - /** - * Represents a template text string - */ - public static class TemplateText extends Node { - - private ArrayList extraSmap = null; - - public TemplateText(String text, Mark start, Node parent) { - super(null, null, text, start, parent); - } - - public void accept(Visitor v) throws JasperException { - v.visit(this); - } - - /** - * Trim all whitespace from the left of the template text - */ - public void ltrim() { - int index = 0; - while ((index < text.length()) && (text.charAt(index) <= ' ')) { - index++; - } - text = text.substring(index); - } - - public void setText(String text) { - this.text = text; - } - - /** - * Trim all whitespace from the right of the template text - */ - public void rtrim() { - int index = text.length(); - while ((index > 0) && (text.charAt(index - 1) <= ' ')) { - index--; - } - text = text.substring(0, index); - } - - /** - * Returns true if this template text contains whitespace only. - */ - public boolean isAllSpace() { - boolean isAllSpace = true; - for (int i = 0; i < text.length(); i++) { - if (!Character.isWhitespace(text.charAt(i))) { - isAllSpace = false; - break; - } - } - return isAllSpace; - } - - /** - * Add a source to Java line mapping - * - * @param srcLine - * The postion of the source line, relative to the line at - * the start of this node. The corresponding java line is - * assumed to be consecutive, i.e. one more than the last. - */ - public void addSmap(int srcLine) { - if (extraSmap == null) { - extraSmap = new ArrayList(); - } - extraSmap.add(new Integer(srcLine)); - } - - public ArrayList getExtraSmap() { - return extraSmap; - } - } - - /*************************************************************************** - * Auxillary classes used in Node - */ - - /** - * Represents attributes that can be request time expressions. - * - * Can either be a plain attribute, an attribute that represents a request - * time expression value, or a named attribute (specified using the - * jsp:attribute standard action). - */ - - public static class JspAttribute { - - private String qName; - - private String uri; - - private String localName; - - private String value; - - private boolean expression; - - private boolean dynamic; - - private final ELNode.Nodes el; - - private final TagAttributeInfo tai; - - // If true, this JspAttribute represents a - private boolean namedAttribute; - - // The node in the parse tree for the NamedAttribute - private NamedAttribute namedAttributeNode; - - JspAttribute(TagAttributeInfo tai, String qName, String uri, - String localName, String value, boolean expr, ELNode.Nodes el, - boolean dyn) { - this.qName = qName; - this.uri = uri; - this.localName = localName; - this.value = value; - this.namedAttributeNode = null; - this.expression = expr; - this.el = el; - this.dynamic = dyn; - this.namedAttribute = false; - this.tai = tai; - } - - /** - * Allow node to validate itself - * - * @param ef - * @param ctx - * @throws ELException - */ - public void validateEL(ExpressionFactory ef, ELContext ctx) - throws ELException { - if (this.el != null) { - // determine exact type - ValueExpression ve = ef.createValueExpression(ctx, this.value, - String.class); - } - } - - /** - * Use this constructor if the JspAttribute represents a named - * attribute. In this case, we have to store the nodes of the body of - * the attribute. - */ - JspAttribute(NamedAttribute na, TagAttributeInfo tai, boolean dyn) { - this.qName = na.getName(); - this.localName = na.getLocalName(); - this.value = null; - this.namedAttributeNode = na; - this.expression = false; - this.el = null; - this.dynamic = dyn; - this.namedAttribute = true; - this.tai = null; - } - - /** - * @return The name of the attribute - */ - public String getName() { - return qName; - } - - /** - * @return The local name of the attribute - */ - public String getLocalName() { - return localName; - } - - /** - * @return The namespace of the attribute, or null if in the default - * namespace - */ - public String getURI() { - return uri; - } - - public TagAttributeInfo getTagAttributeInfo() { - return this.tai; - } - - /** - * - * @return return true if there's TagAttributeInfo meaning we need to - * assign a ValueExpression - */ - public boolean isDeferredInput() { - return (this.tai != null) ? this.tai.isDeferredValue() : false; - } - - /** - * - * @return return true if there's TagAttributeInfo meaning we need to - * assign a MethodExpression - */ - public boolean isDeferredMethodInput() { - return (this.tai != null) ? this.tai.isDeferredMethod() : false; - } - - public String getExpectedTypeName() { - if (this.tai != null) { - if (this.isDeferredInput()) { - return this.tai.getExpectedTypeName(); - } else if (this.isDeferredMethodInput()) { - String m = this.tai.getMethodSignature(); - if (m != null) { - int rti = m.trim().indexOf(' '); - if (rti > 0) { - return m.substring(0, rti).trim(); - } - } - } - } - return "java.lang.Object"; - } - - public String[] getParameterTypeNames() { - if (this.tai != null) { - if (this.isDeferredMethodInput()) { - String m = this.tai.getMethodSignature(); - if (m != null) { - m = m.trim(); - m = m.substring(m.indexOf('(') + 1); - m = m.substring(0, m.length() - 1); - if (m.trim().length() > 0) { - String[] p = m.split(","); - for (int i = 0; i < p.length; i++) { - p[i] = p[i].trim(); - } - return p; - } - } - } - } - return new String[0]; - } - - /** - * Only makes sense if namedAttribute is false. - * - * @return the value for the attribute, or the expression string - * (stripped of "<%=", "%>", "%=", or "%" but containing "${" - * and "}" for EL expressions) - */ - public String getValue() { - return value; - } - - /** - * Only makes sense if namedAttribute is true. - * - * @return the nodes that evaluate to the body of this attribute. - */ - public NamedAttribute getNamedAttributeNode() { - return namedAttributeNode; - } - - /** - * @return true if the value represents a traditional rtexprvalue - */ - public boolean isExpression() { - return expression; - } - - /** - * @return true if the value represents a NamedAttribute value. - */ - public boolean isNamedAttribute() { - return namedAttribute; - } - - /** - * @return true if the value represents an expression that should be fed - * to the expression interpreter - * @return false for string literals or rtexprvalues that should not be - * interpreted or reevaluated - */ - public boolean isELInterpreterInput() { - return el != null || this.isDeferredInput() - || this.isDeferredMethodInput(); - } - - /** - * @return true if the value is a string literal known at translation - * time. - */ - public boolean isLiteral() { - return !expression && (el != null) && !namedAttribute; - } - - /** - * XXX - */ - public boolean isDynamic() { - return dynamic; - } - - public ELNode.Nodes getEL() { - return el; - } - } - - /** - * An ordered list of Node, used to represent the body of an element, or a - * jsp page of jsp document. - */ - public static class Nodes { - - private List list; - - private Node.Root root; // null if this is not a page - - private boolean generatedInBuffer; - - public Nodes() { - list = new Vector(); - } - - public Nodes(Node.Root root) { - this.root = root; - list = new Vector(); - list.add(root); - } - - /** - * Appends a node to the list - * - * @param n - * The node to add - */ - public void add(Node n) { - list.add(n); - root = null; - } - - /** - * Removes the given node from the list. - * - * @param n - * The node to be removed - */ - public void remove(Node n) { - list.remove(n); - } - - /** - * Visit the nodes in the list with the supplied visitor - * - * @param v - * The visitor used - */ - public void visit(Visitor v) throws JasperException { - Iterator iter = list.iterator(); - while (iter.hasNext()) { - Node n = (Node) iter.next(); - n.accept(v); - } - } - - public int size() { - return list.size(); - } - - public Node getNode(int index) { - Node n = null; - try { - n = (Node) list.get(index); - } catch (ArrayIndexOutOfBoundsException e) { - } - return n; - } - - public Node.Root getRoot() { - return root; - } - - public boolean isGeneratedInBuffer() { - return generatedInBuffer; - } - - public void setGeneratedInBuffer(boolean g) { - generatedInBuffer = g; - } - } - - /** - * A visitor class for visiting the node. This class also provides the - * default action (i.e. nop) for each of the child class of the Node. An - * actual visitor should extend this class and supply the visit method for - * the nodes that it cares. - */ - public static class Visitor { - - /** - * This method provides a place to put actions that are common to all - * nodes. Override this in the child visitor class if need to. - */ - protected void doVisit(Node n) throws JasperException { - } - - /** - * Visit the body of a node, using the current visitor - */ - protected void visitBody(Node n) throws JasperException { - if (n.getBody() != null) { - n.getBody().visit(this); - } - } - - public void visit(Root n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(JspRoot n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(PageDirective n) throws JasperException { - doVisit(n); - } - - public void visit(TagDirective n) throws JasperException { - doVisit(n); - } - - public void visit(IncludeDirective n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(TaglibDirective n) throws JasperException { - doVisit(n); - } - - public void visit(AttributeDirective n) throws JasperException { - doVisit(n); - } - - public void visit(VariableDirective n) throws JasperException { - doVisit(n); - } - - public void visit(Comment n) throws JasperException { - doVisit(n); - } - - public void visit(Declaration n) throws JasperException { - doVisit(n); - } - - public void visit(Expression n) throws JasperException { - doVisit(n); - } - - public void visit(Scriptlet n) throws JasperException { - doVisit(n); - } - - public void visit(ELExpression n) throws JasperException { - doVisit(n); - } - - public void visit(IncludeAction n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(ForwardAction n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(GetProperty n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(SetProperty n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(ParamAction n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(ParamsAction n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(FallBackAction n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(UseBean n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(PlugIn n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(CustomTag n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(UninterpretedTag n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(JspElement n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(JspText n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(NamedAttribute n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(JspBody n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(InvokeAction n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(DoBodyAction n) throws JasperException { - doVisit(n); - visitBody(n); - } - - public void visit(TemplateText n) throws JasperException { - doVisit(n); - } - - public void visit(JspOutput n) throws JasperException { - doVisit(n); - } - - public void visit(AttributeGenerator n) throws JasperException { - doVisit(n); - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/PageDataImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/PageDataImpl.java deleted file mode 100644 index deb4adfe2..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/PageDataImpl.java +++ /dev/null @@ -1,711 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import java.io.InputStream; -import java.io.ByteArrayInputStream; -import java.io.CharArrayWriter; -import java.io.UnsupportedEncodingException; -import java.util.ListIterator; -import javax.servlet.jsp.tagext.PageData; -import org.xml.sax.Attributes; -import org.xml.sax.helpers.AttributesImpl; -import org.apache.jasper.JasperException; - -/** - * An implementation of javax.servlet.jsp.tagext.PageData which - * builds the XML view of a given page. - * - * The XML view is built in two passes: - * - * During the first pass, the FirstPassVisitor collects the attributes of the - * top-level jsp:root and those of the jsp:root elements of any included - * pages, and adds them to the jsp:root element of the XML view. - * In addition, any taglib directives are converted into xmlns: attributes and - * added to the jsp:root element of the XML view. - * This pass ignores any nodes other than JspRoot and TaglibDirective. - * - * During the second pass, the SecondPassVisitor produces the XML view, using - * the combined jsp:root attributes determined in the first pass and any - * remaining pages nodes (this pass ignores any JspRoot and TaglibDirective - * nodes). - * - * @author Jan Luehe - */ -class PageDataImpl extends PageData implements TagConstants { - - private static final String JSP_VERSION = "2.0"; - private static final String CDATA_START_SECTION = "\n"; - - // string buffer used to build XML view - private StringBuffer buf; - - /** - * Constructor. - * - * @param page the page nodes from which to generate the XML view - */ - public PageDataImpl(Node.Nodes page, Compiler compiler) - throws JasperException { - - // First pass - FirstPassVisitor firstPass = new FirstPassVisitor(page.getRoot(), - compiler.getPageInfo()); - page.visit(firstPass); - - // Second pass - buf = new StringBuffer(); - SecondPassVisitor secondPass - = new SecondPassVisitor(page.getRoot(), buf, compiler, - firstPass.getJspIdPrefix()); - page.visit(secondPass); - } - - /** - * Returns the input stream of the XML view. - * - * @return the input stream of the XML view - */ - public InputStream getInputStream() { - // Turn StringBuffer into InputStream - try { - return new ByteArrayInputStream(buf.toString().getBytes("UTF-8")); - } catch (UnsupportedEncodingException uee) { - // should never happen - throw new RuntimeException(uee.toString()); - } - } - - /* - * First-pass Visitor for JspRoot nodes (representing jsp:root elements) - * and TablibDirective nodes, ignoring any other nodes. - * - * The purpose of this Visitor is to collect the attributes of the - * top-level jsp:root and those of the jsp:root elements of any included - * pages, and add them to the jsp:root element of the XML view. - * In addition, this Visitor converts any taglib directives into xmlns: - * attributes and adds them to the jsp:root element of the XML view. - */ - static class FirstPassVisitor - extends Node.Visitor implements TagConstants { - - private Node.Root root; - private AttributesImpl rootAttrs; - private PageInfo pageInfo; - - // Prefix for the 'id' attribute - private String jspIdPrefix; - - /* - * Constructor - */ - public FirstPassVisitor(Node.Root root, PageInfo pageInfo) { - this.root = root; - this.pageInfo = pageInfo; - this.rootAttrs = new AttributesImpl(); - this.rootAttrs.addAttribute("", "", "version", "CDATA", - JSP_VERSION); - this.jspIdPrefix = "jsp"; - } - - public void visit(Node.Root n) throws JasperException { - visitBody(n); - if (n == root) { - /* - * Top-level page. - * - * Add - * xmlns:jsp="http://java.sun.com/JSP/Page" - * attribute only if not already present. - */ - if (!JSP_URI.equals(rootAttrs.getValue("xmlns:jsp"))) { - rootAttrs.addAttribute("", "", "xmlns:jsp", "CDATA", - JSP_URI); - } - - if (pageInfo.isJspPrefixHijacked()) { - /* - * 'jsp' prefix has been hijacked, that is, bound to a - * namespace other than the JSP namespace. This means that - * when adding an 'id' attribute to each element, we can't - * use the 'jsp' prefix. Therefore, create a new prefix - * (one that is unique across the translation unit) for use - * by the 'id' attribute, and bind it to the JSP namespace - */ - jspIdPrefix += "jsp"; - while (pageInfo.containsPrefix(jspIdPrefix)) { - jspIdPrefix += "jsp"; - } - rootAttrs.addAttribute("", "", "xmlns:" + jspIdPrefix, - "CDATA", JSP_URI); - } - - root.setAttributes(rootAttrs); - } - } - - public void visit(Node.JspRoot n) throws JasperException { - addAttributes(n.getTaglibAttributes()); - addAttributes(n.getNonTaglibXmlnsAttributes()); - addAttributes(n.getAttributes()); - - visitBody(n); - } - - /* - * Converts taglib directive into "xmlns:..." attribute of jsp:root - * element. - */ - public void visit(Node.TaglibDirective n) throws JasperException { - Attributes attrs = n.getAttributes(); - if (attrs != null) { - String qName = "xmlns:" + attrs.getValue("prefix"); - /* - * According to javadocs of org.xml.sax.helpers.AttributesImpl, - * the addAttribute method does not check to see if the - * specified attribute is already contained in the list: This - * is the application's responsibility! - */ - if (rootAttrs.getIndex(qName) == -1) { - String location = attrs.getValue("uri"); - if (location != null) { - if (location.startsWith("/")) { - location = URN_JSPTLD + location; - } - rootAttrs.addAttribute("", "", qName, "CDATA", - location); - } else { - location = attrs.getValue("tagdir"); - rootAttrs.addAttribute("", "", qName, "CDATA", - URN_JSPTAGDIR + location); - } - } - } - } - - public String getJspIdPrefix() { - return jspIdPrefix; - } - - private void addAttributes(Attributes attrs) { - if (attrs != null) { - int len = attrs.getLength(); - - for (int i=0; i"); - } - buf.append("${"); - buf.append(JspUtil.escapeXml(n.getText())); - buf.append("}"); - if (!n.getRoot().isXmlSyntax()) { - buf.append(JSP_TEXT_ACTION_END); - } - buf.append("\n"); - } - - public void visit(Node.IncludeAction n) throws JasperException { - appendTag(n); - } - - public void visit(Node.ForwardAction n) throws JasperException { - appendTag(n); - } - - public void visit(Node.GetProperty n) throws JasperException { - appendTag(n); - } - - public void visit(Node.SetProperty n) throws JasperException { - appendTag(n); - } - - public void visit(Node.ParamAction n) throws JasperException { - appendTag(n); - } - - public void visit(Node.ParamsAction n) throws JasperException { - appendTag(n); - } - - public void visit(Node.FallBackAction n) throws JasperException { - appendTag(n); - } - - public void visit(Node.UseBean n) throws JasperException { - appendTag(n); - } - - public void visit(Node.PlugIn n) throws JasperException { - appendTag(n); - } - - public void visit(Node.NamedAttribute n) throws JasperException { - appendTag(n); - } - - public void visit(Node.JspBody n) throws JasperException { - appendTag(n); - } - - public void visit(Node.CustomTag n) throws JasperException { - boolean resetDefaultNSSave = resetDefaultNS; - appendTag(n, resetDefaultNS); - resetDefaultNS = resetDefaultNSSave; - } - - public void visit(Node.UninterpretedTag n) throws JasperException { - boolean resetDefaultNSSave = resetDefaultNS; - appendTag(n, resetDefaultNS); - resetDefaultNS = resetDefaultNSSave; - } - - public void visit(Node.JspText n) throws JasperException { - appendTag(n); - } - - public void visit(Node.DoBodyAction n) throws JasperException { - appendTag(n); - } - - public void visit(Node.InvokeAction n) throws JasperException { - appendTag(n); - } - - public void visit(Node.TagDirective n) throws JasperException { - appendTagDirective(n); - } - - public void visit(Node.AttributeDirective n) throws JasperException { - appendTag(n); - } - - public void visit(Node.VariableDirective n) throws JasperException { - appendTag(n); - } - - public void visit(Node.TemplateText n) throws JasperException { - /* - * If the template text came from a JSP page written in JSP syntax, - * create a jsp:text element for it (JSP 5.3.2). - */ - appendText(n.getText(), !n.getRoot().isXmlSyntax()); - } - - /* - * Appends the given tag, including its body, to the XML view. - */ - private void appendTag(Node n) throws JasperException { - appendTag(n, false); - } - - /* - * Appends the given tag, including its body, to the XML view, - * and optionally reset default namespace to "", if none specified. - */ - private void appendTag(Node n, boolean addDefaultNS) - throws JasperException { - - Node.Nodes body = n.getBody(); - String text = n.getText(); - - buf.append("<").append(n.getQName()); - buf.append("\n"); - - printAttributes(n, addDefaultNS); - buf.append(" ").append(jspIdPrefix).append(":id").append("=\""); - buf.append(jspId++).append("\"\n"); - - if (ROOT_ACTION.equals(n.getLocalName()) || body != null - || text != null) { - buf.append(">\n"); - if (ROOT_ACTION.equals(n.getLocalName())) { - if (compiler.getCompilationContext().isTagFile()) { - appendTagDirective(); - } else { - appendPageDirective(); - } - } - if (body != null) { - body.visit(this); - } else { - appendText(text, false); - } - buf.append("\n"); - } else { - buf.append("/>\n"); - } - } - - /* - * Appends the page directive with the given attributes to the XML - * view. - * - * Since the import attribute of the page directive is the only page - * attribute that is allowed to appear multiple times within the same - * document, and since XML allows only single-value attributes, - * the values of multiple import attributes must be combined into one, - * separated by comma. - * - * If the given page directive contains just 'contentType' and/or - * 'pageEncoding' attributes, we ignore it, as we've already appended - * a page directive containing just these two attributes. - */ - private void appendPageDirective(Node.PageDirective n) { - boolean append = false; - Attributes attrs = n.getAttributes(); - int len = (attrs == null) ? 0 : attrs.getLength(); - for (int i=0; i 0) { - // Concatenate names of imported classes/packages - boolean first = true; - ListIterator iter = n.getImports().listIterator(); - while (iter.hasNext()) { - if (first) { - first = false; - buf.append(" import=\""); - } else { - buf.append(","); - } - buf.append(JspUtil.getExprInXml((String) iter.next())); - } - buf.append("\"\n"); - } - buf.append("/>\n"); - } - - /* - * Appends a page directive with 'pageEncoding' and 'contentType' - * attributes. - * - * The value of the 'pageEncoding' attribute is hard-coded - * to UTF-8, whereas the value of the 'contentType' attribute, which - * is identical to what the container will pass to - * ServletResponse.setContentType(), is derived from the pageInfo. - */ - private void appendPageDirective() { - buf.append("<").append(JSP_PAGE_DIRECTIVE_ACTION); - buf.append("\n"); - - // append jsp:id - buf.append(" ").append(jspIdPrefix).append(":id").append("=\""); - buf.append(jspId++).append("\"\n"); - buf.append(" ").append("pageEncoding").append("=\"UTF-8\"\n"); - buf.append(" ").append("contentType").append("=\""); - buf.append(compiler.getPageInfo().getContentType()).append("\"\n"); - buf.append("/>\n"); - } - - /* - * Appends the tag directive with the given attributes to the XML - * view. - * - * If the given tag directive contains just a 'pageEncoding' - * attributes, we ignore it, as we've already appended - * a tag directive containing just this attributes. - */ - private void appendTagDirective(Node.TagDirective n) - throws JasperException { - - boolean append = false; - Attributes attrs = n.getAttributes(); - int len = (attrs == null) ? 0 : attrs.getLength(); - for (int i=0; i\n"); - } - - private void appendText(String text, boolean createJspTextElement) { - if (createJspTextElement) { - buf.append("<").append(JSP_TEXT_ACTION); - buf.append("\n"); - - // append jsp:id - buf.append(" ").append(jspIdPrefix).append(":id").append("=\""); - buf.append(jspId++).append("\"\n"); - buf.append(">\n"); - - appendCDATA(text); - buf.append(JSP_TEXT_ACTION_END); - buf.append("\n"); - } else { - appendCDATA(text); - } - } - - /* - * Appends the given text as a CDATA section to the XML view, unless - * the text has already been marked as CDATA. - */ - private void appendCDATA(String text) { - buf.append(CDATA_START_SECTION); - buf.append(escapeCDATA(text)); - buf.append(CDATA_END_SECTION); - } - - /* - * Escapes any occurrences of "]]>" (by replacing them with "]]>") - * within the given text, so it can be included in a CDATA section. - */ - private String escapeCDATA(String text) { - if( text==null ) return ""; - int len = text.length(); - CharArrayWriter result = new CharArrayWriter(len); - for (int i=0; i')) { - // match found - result.write(']'); - result.write(']'); - result.write('&'); - result.write('g'); - result.write('t'); - result.write(';'); - i += 2; - } else { - result.write(text.charAt(i)); - } - } - return result.toString(); - } - - /* - * Appends the attributes of the given Node to the XML view. - */ - private void printAttributes(Node n, boolean addDefaultNS) { - - /* - * Append "xmlns" attributes that represent tag libraries - */ - Attributes attrs = n.getTaglibAttributes(); - int len = (attrs == null) ? 0 : attrs.getLength(); - for (int i=0; i\n"); - } - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/PageInfo.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/PageInfo.java deleted file mode 100644 index 5a016fc39..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/PageInfo.java +++ /dev/null @@ -1,711 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import java.util.Collection; -import java.util.HashMap; -import java.util.HashSet; -import java.util.LinkedList; -import java.util.List; -import java.util.Vector; - -import org.apache.el.ExpressionFactoryImpl; -import org.apache.jasper.Constants; -import org.apache.jasper.JasperException; - -import javax.el.ExpressionFactory; -import javax.servlet.jsp.tagext.TagLibraryInfo; - -/** - * A repository for various info about the translation unit under compilation. - * - * @author Kin-man Chung - */ - -class PageInfo { - - private Vector imports; - private Vector dependants; - - private BeanRepository beanRepository; - private HashMap taglibsMap; - private HashMap jspPrefixMapper; - private HashMap xmlPrefixMapper; - private HashMap nonCustomTagPrefixMap; - private String jspFile; - private String defaultLanguage = "java"; - private String language; - private String defaultExtends = Constants.JSP_SERVLET_BASE; - private String xtends; - private String contentType = null; - private String session; - private boolean isSession = true; - private String bufferValue; - private int buffer = 8*1024; // XXX confirm - private String autoFlush; - private boolean isAutoFlush = true; - private String isThreadSafeValue; - private boolean isThreadSafe = true; - private String isErrorPageValue; - private boolean isErrorPage = false; - private String errorPage = null; - private String info; - - private boolean scriptless = false; - private boolean scriptingInvalid = false; - - private String isELIgnoredValue; - private boolean isELIgnored = false; - - // JSP 2.1 - private String deferredSyntaxAllowedAsLiteralValue; - private boolean deferredSyntaxAllowedAsLiteral = false; - private ExpressionFactory expressionFactory = new ExpressionFactoryImpl(); - private String trimDirectiveWhitespacesValue; - private boolean trimDirectiveWhitespaces = false; - - private String omitXmlDecl = null; - private String doctypeName = null; - private String doctypePublic = null; - private String doctypeSystem = null; - - private boolean isJspPrefixHijacked; - - // Set of all element and attribute prefixes used in this translation unit - private HashSet prefixes; - - private boolean hasJspRoot = false; - private Vector includePrelude; - private Vector includeCoda; - private Vector pluginDcls; // Id's for tagplugin declarations - - - PageInfo(BeanRepository beanRepository, String jspFile) { - - this.jspFile = jspFile; - this.beanRepository = beanRepository; - this.taglibsMap = new HashMap(); - this.jspPrefixMapper = new HashMap(); - this.xmlPrefixMapper = new HashMap(); - this.nonCustomTagPrefixMap = new HashMap(); - this.imports = new Vector(); - this.dependants = new Vector(); - this.includePrelude = new Vector(); - this.includeCoda = new Vector(); - this.pluginDcls = new Vector(); - this.prefixes = new HashSet(); - - // Enter standard imports - for(int i = 0; i < Constants.STANDARD_IMPORTS.length; i++) - imports.add(Constants.STANDARD_IMPORTS[i]); - } - - /** - * Check if the plugin ID has been previously declared. Make a not - * that this Id is now declared. - * @return true if Id has been declared. - */ - public boolean isPluginDeclared(String id) { - if (pluginDcls.contains(id)) - return true; - pluginDcls.add(id); - return false; - } - - public void addImports(List imports) { - this.imports.addAll(imports); - } - - public void addImport(String imp) { - this.imports.add(imp); - } - - public List getImports() { - return imports; - } - - public String getJspFile() { - return jspFile; - } - - public void addDependant(String d) { - if (!dependants.contains(d) && !jspFile.equals(d)) - dependants.add(d); - } - - public List getDependants() { - return dependants; - } - - public BeanRepository getBeanRepository() { - return beanRepository; - } - - public void setScriptless(boolean s) { - scriptless = s; - } - - public boolean isScriptless() { - return scriptless; - } - - public void setScriptingInvalid(boolean s) { - scriptingInvalid = s; - } - - public boolean isScriptingInvalid() { - return scriptingInvalid; - } - - public List getIncludePrelude() { - return includePrelude; - } - - public void setIncludePrelude(Vector prelude) { - includePrelude = prelude; - } - - public List getIncludeCoda() { - return includeCoda; - } - - public void setIncludeCoda(Vector coda) { - includeCoda = coda; - } - - public void setHasJspRoot(boolean s) { - hasJspRoot = s; - } - - public boolean hasJspRoot() { - return hasJspRoot; - } - - public String getOmitXmlDecl() { - return omitXmlDecl; - } - - public void setOmitXmlDecl(String omit) { - omitXmlDecl = omit; - } - - public String getDoctypeName() { - return doctypeName; - } - - public void setDoctypeName(String doctypeName) { - this.doctypeName = doctypeName; - } - - public String getDoctypeSystem() { - return doctypeSystem; - } - - public void setDoctypeSystem(String doctypeSystem) { - this.doctypeSystem = doctypeSystem; - } - - public String getDoctypePublic() { - return doctypePublic; - } - - public void setDoctypePublic(String doctypePublic) { - this.doctypePublic = doctypePublic; - } - - /* Tag library and XML namespace management methods */ - - public void setIsJspPrefixHijacked(boolean isHijacked) { - isJspPrefixHijacked = isHijacked; - } - - public boolean isJspPrefixHijacked() { - return isJspPrefixHijacked; - } - - /* - * Adds the given prefix to the set of prefixes of this translation unit. - * - * @param prefix The prefix to add - */ - public void addPrefix(String prefix) { - prefixes.add(prefix); - } - - /* - * Checks to see if this translation unit contains the given prefix. - * - * @param prefix The prefix to check - * - * @return true if this translation unit contains the given prefix, false - * otherwise - */ - public boolean containsPrefix(String prefix) { - return prefixes.contains(prefix); - } - - /* - * Maps the given URI to the given tag library. - * - * @param uri The URI to map - * @param info The tag library to be associated with the given URI - */ - public void addTaglib(String uri, TagLibraryInfo info) { - taglibsMap.put(uri, info); - } - - /* - * Gets the tag library corresponding to the given URI. - * - * @return Tag library corresponding to the given URI - */ - public TagLibraryInfo getTaglib(String uri) { - return (TagLibraryInfo) taglibsMap.get(uri); - } - - /* - * Gets the collection of tag libraries that are associated with a URI - * - * @return Collection of tag libraries that are associated with a URI - */ - public Collection getTaglibs() { - return taglibsMap.values(); - } - - /* - * Checks to see if the given URI is mapped to a tag library. - * - * @param uri The URI to map - * - * @return true if the given URI is mapped to a tag library, false - * otherwise - */ - public boolean hasTaglib(String uri) { - return taglibsMap.containsKey(uri); - } - - /* - * Maps the given prefix to the given URI. - * - * @param prefix The prefix to map - * @param uri The URI to be associated with the given prefix - */ - public void addPrefixMapping(String prefix, String uri) { - jspPrefixMapper.put(prefix, uri); - } - - /* - * Pushes the given URI onto the stack of URIs to which the given prefix - * is mapped. - * - * @param prefix The prefix whose stack of URIs is to be pushed - * @param uri The URI to be pushed onto the stack - */ - public void pushPrefixMapping(String prefix, String uri) { - LinkedList stack = (LinkedList) xmlPrefixMapper.get(prefix); - if (stack == null) { - stack = new LinkedList(); - xmlPrefixMapper.put(prefix, stack); - } - stack.addFirst(uri); - } - - /* - * Removes the URI at the top of the stack of URIs to which the given - * prefix is mapped. - * - * @param prefix The prefix whose stack of URIs is to be popped - */ - public void popPrefixMapping(String prefix) { - LinkedList stack = (LinkedList) xmlPrefixMapper.get(prefix); - if (stack == null || stack.size() == 0) { - // XXX throw new Exception("XXX"); - } - stack.removeFirst(); - } - - /* - * Returns the URI to which the given prefix maps. - * - * @param prefix The prefix whose URI is sought - * - * @return The URI to which the given prefix maps - */ - public String getURI(String prefix) { - - String uri = null; - - LinkedList stack = (LinkedList) xmlPrefixMapper.get(prefix); - if (stack == null || stack.size() == 0) { - uri = (String) jspPrefixMapper.get(prefix); - } else { - uri = (String) stack.getFirst(); - } - - return uri; - } - - - /* Page/Tag directive attributes */ - - /* - * language - */ - public void setLanguage(String value, Node n, ErrorDispatcher err, - boolean pagedir) - throws JasperException { - - if (!"java".equalsIgnoreCase(value)) { - if (pagedir) - err.jspError(n, "jsp.error.page.language.nonjava"); - else - err.jspError(n, "jsp.error.tag.language.nonjava"); - } - - language = value; - } - - public String getLanguage(boolean useDefault) { - return (language == null && useDefault ? defaultLanguage : language); - } - - public String getLanguage() { - return getLanguage(true); - } - - - /* - * extends - */ - public void setExtends(String value, Node.PageDirective n) { - - xtends = value; - - /* - * If page superclass is top level class (i.e. not in a package) - * explicitly import it. If this is not done, the compiler will assume - * the extended class is in the same pkg as the generated servlet. - */ - if (value.indexOf('.') < 0) - n.addImport(value); - } - - /** - * Gets the value of the 'extends' page directive attribute. - * - * @param useDefault TRUE if the default - * (org.apache.jasper.runtime.HttpJspBase) should be returned if this - * attribute has not been set, FALSE otherwise - * - * @return The value of the 'extends' page directive attribute, or the - * default (org.apache.jasper.runtime.HttpJspBase) if this attribute has - * not been set and useDefault is TRUE - */ - public String getExtends(boolean useDefault) { - return (xtends == null && useDefault ? defaultExtends : xtends); - } - - /** - * Gets the value of the 'extends' page directive attribute. - * - * @return The value of the 'extends' page directive attribute, or the - * default (org.apache.jasper.runtime.HttpJspBase) if this attribute has - * not been set - */ - public String getExtends() { - return getExtends(true); - } - - - /* - * contentType - */ - public void setContentType(String value) { - contentType = value; - } - - public String getContentType() { - return contentType; - } - - - /* - * buffer - */ - public void setBufferValue(String value, Node n, ErrorDispatcher err) - throws JasperException { - - if ("none".equalsIgnoreCase(value)) - buffer = 0; - else { - if (value == null || !value.endsWith("kb")) - err.jspError(n, "jsp.error.page.invalid.buffer"); - try { - Integer k = new Integer(value.substring(0, value.length()-2)); - buffer = k.intValue() * 1024; - } catch (NumberFormatException e) { - err.jspError(n, "jsp.error.page.invalid.buffer"); - } - } - - bufferValue = value; - } - - public String getBufferValue() { - return bufferValue; - } - - public int getBuffer() { - return buffer; - } - - - /* - * session - */ - public void setSession(String value, Node n, ErrorDispatcher err) - throws JasperException { - - if ("true".equalsIgnoreCase(value)) - isSession = true; - else if ("false".equalsIgnoreCase(value)) - isSession = false; - else - err.jspError(n, "jsp.error.page.invalid.session"); - - session = value; - } - - public String getSession() { - return session; - } - - public boolean isSession() { - return isSession; - } - - - /* - * autoFlush - */ - public void setAutoFlush(String value, Node n, ErrorDispatcher err) - throws JasperException { - - if ("true".equalsIgnoreCase(value)) - isAutoFlush = true; - else if ("false".equalsIgnoreCase(value)) - isAutoFlush = false; - else - err.jspError(n, "jsp.error.autoFlush.invalid"); - - autoFlush = value; - } - - public String getAutoFlush() { - return autoFlush; - } - - public boolean isAutoFlush() { - return isAutoFlush; - } - - - /* - * isThreadSafe - */ - public void setIsThreadSafe(String value, Node n, ErrorDispatcher err) - throws JasperException { - - if ("true".equalsIgnoreCase(value)) - isThreadSafe = true; - else if ("false".equalsIgnoreCase(value)) - isThreadSafe = false; - else - err.jspError(n, "jsp.error.page.invalid.isthreadsafe"); - - isThreadSafeValue = value; - } - - public String getIsThreadSafe() { - return isThreadSafeValue; - } - - public boolean isThreadSafe() { - return isThreadSafe; - } - - - /* - * info - */ - public void setInfo(String value) { - info = value; - } - - public String getInfo() { - return info; - } - - - /* - * errorPage - */ - public void setErrorPage(String value) { - errorPage = value; - } - - public String getErrorPage() { - return errorPage; - } - - - /* - * isErrorPage - */ - public void setIsErrorPage(String value, Node n, ErrorDispatcher err) - throws JasperException { - - if ("true".equalsIgnoreCase(value)) - isErrorPage = true; - else if ("false".equalsIgnoreCase(value)) - isErrorPage = false; - else - err.jspError(n, "jsp.error.page.invalid.iserrorpage"); - - isErrorPageValue = value; - } - - public String getIsErrorPage() { - return isErrorPageValue; - } - - public boolean isErrorPage() { - return isErrorPage; - } - - - /* - * isELIgnored - */ - public void setIsELIgnored(String value, Node n, ErrorDispatcher err, - boolean pagedir) - throws JasperException { - - if ("true".equalsIgnoreCase(value)) - isELIgnored = true; - else if ("false".equalsIgnoreCase(value)) - isELIgnored = false; - else { - if (pagedir) - err.jspError(n, "jsp.error.page.invalid.iselignored"); - else - err.jspError(n, "jsp.error.tag.invalid.iselignored"); - } - - isELIgnoredValue = value; - } - - /* - * deferredSyntaxAllowedAsLiteral - */ - public void setDeferredSyntaxAllowedAsLiteral(String value, Node n, ErrorDispatcher err, - boolean pagedir) - throws JasperException { - - if ("true".equalsIgnoreCase(value)) - deferredSyntaxAllowedAsLiteral = true; - else if ("false".equalsIgnoreCase(value)) - deferredSyntaxAllowedAsLiteral = false; - else { - if (pagedir) - err.jspError(n, "jsp.error.page.invalid.deferredsyntaxallowedasliteral"); - else - err.jspError(n, "jsp.error.tag.invalid.deferredsyntaxallowedasliteral"); - } - - deferredSyntaxAllowedAsLiteralValue = value; - } - - /* - * trimDirectiveWhitespaces - */ - public void setTrimDirectiveWhitespaces(String value, Node n, ErrorDispatcher err, - boolean pagedir) - throws JasperException { - - if ("true".equalsIgnoreCase(value)) - trimDirectiveWhitespaces = true; - else if ("false".equalsIgnoreCase(value)) - trimDirectiveWhitespaces = false; - else { - if (pagedir) - err.jspError(n, "jsp.error.page.invalid.trimdirectivewhitespaces"); - else - err.jspError(n, "jsp.error.tag.invalid.trimdirectivewhitespaces"); - } - - trimDirectiveWhitespacesValue = value; - } - - public void setELIgnored(boolean s) { - isELIgnored = s; - } - - public String getIsELIgnored() { - return isELIgnoredValue; - } - - public boolean isELIgnored() { - return isELIgnored; - } - - public void putNonCustomTagPrefix(String prefix, Mark where) { - nonCustomTagPrefixMap.put(prefix, where); - } - - public Mark getNonCustomTagPrefix(String prefix) { - return (Mark) nonCustomTagPrefixMap.get(prefix); - } - - public String getDeferredSyntaxAllowedAsLiteral() { - return deferredSyntaxAllowedAsLiteralValue; - } - - public boolean isDeferredSyntaxAllowedAsLiteral() { - return deferredSyntaxAllowedAsLiteral; - } - - public void setDeferredSyntaxAllowedAsLiteral(boolean isELDeferred) { - this.deferredSyntaxAllowedAsLiteral = isELDeferred; - } - - public ExpressionFactory getExpressionFactory() { - return expressionFactory; - } - - public String getTrimDirectiveWhitespaces() { - return trimDirectiveWhitespacesValue; - } - - public boolean isTrimDirectiveWhitespaces() { - return trimDirectiveWhitespaces; - } - - public void setTrimDirectiveWhitespaces(boolean trimDirectiveWhitespaces) { - this.trimDirectiveWhitespaces = trimDirectiveWhitespaces; - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Parser.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Parser.java deleted file mode 100644 index f302e99df..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Parser.java +++ /dev/null @@ -1,1791 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import java.io.CharArrayWriter; -import java.io.FileNotFoundException; -import java.net.URL; -import java.util.Iterator; -import java.util.List; - -import javax.servlet.jsp.tagext.TagAttributeInfo; -import javax.servlet.jsp.tagext.TagFileInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagLibraryInfo; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.xml.sax.Attributes; -import org.xml.sax.helpers.AttributesImpl; - -/** - * This class implements a parser for a JSP page (non-xml view). JSP page - * grammar is included here for reference. The token '#' that appears in the - * production indicates the current input token location in the production. - * - * @author Kin-man Chung - * @author Shawn Bayern - * @author Mark Roth - */ - -class Parser implements TagConstants { - - private ParserController parserController; - - private JspCompilationContext ctxt; - - private JspReader reader; - - private String currentFile; - - private Mark start; - - private ErrorDispatcher err; - - private int scriptlessCount; - - private boolean isTagFile; - - private boolean directivesOnly; - - private URL jarFileUrl; - - private PageInfo pageInfo; - - // Virtual body content types, to make parsing a little easier. - // These are not accessible from outside the parser. - private static final String JAVAX_BODY_CONTENT_PARAM = "JAVAX_BODY_CONTENT_PARAM"; - - private static final String JAVAX_BODY_CONTENT_PLUGIN = "JAVAX_BODY_CONTENT_PLUGIN"; - - private static final String JAVAX_BODY_CONTENT_TEMPLATE_TEXT = "JAVAX_BODY_CONTENT_TEMPLATE_TEXT"; - - private static final boolean STRICT_QUOTE_ESCAPING = Boolean.valueOf( - System.getProperty( - "org.apache.jasper.compiler.Parser.STRICT_QUOTE_ESCAPING", - "true")).booleanValue(); - - /** - * The constructor - */ - private Parser(ParserController pc, JspReader reader, boolean isTagFile, - boolean directivesOnly, URL jarFileUrl) { - this.parserController = pc; - this.ctxt = pc.getJspCompilationContext(); - this.pageInfo = pc.getCompiler().getPageInfo(); - this.err = pc.getCompiler().getErrorDispatcher(); - this.reader = reader; - this.currentFile = reader.mark().getFile(); - this.scriptlessCount = 0; - this.isTagFile = isTagFile; - this.directivesOnly = directivesOnly; - this.jarFileUrl = jarFileUrl; - start = reader.mark(); - } - - /** - * The main entry for Parser - * - * @param pc - * The ParseController, use for getting other objects in compiler - * and for parsing included pages - * @param reader - * To read the page - * @param parent - * The parent node to this page, null for top level page - * @return list of nodes representing the parsed page - */ - public static Node.Nodes parse(ParserController pc, JspReader reader, - Node parent, boolean isTagFile, boolean directivesOnly, - URL jarFileUrl, String pageEnc, String jspConfigPageEnc, - boolean isDefaultPageEncoding, boolean isBomPresent) throws JasperException { - - Parser parser = new Parser(pc, reader, isTagFile, directivesOnly, - jarFileUrl); - - Node.Root root = new Node.Root(reader.mark(), parent, false); - root.setPageEncoding(pageEnc); - root.setJspConfigPageEncoding(jspConfigPageEnc); - root.setIsDefaultPageEncoding(isDefaultPageEncoding); - root.setIsBomPresent(isBomPresent); - - if (directivesOnly) { - parser.parseTagFileDirectives(root); - return new Node.Nodes(root); - } - - // For the Top level page, add inlcude-prelude and include-coda - PageInfo pageInfo = pc.getCompiler().getPageInfo(); - if (parent == null) { - parser.addInclude(root, pageInfo.getIncludePrelude()); - } - while (reader.hasMoreInput()) { - parser.parseElements(root); - } - if (parent == null) { - parser.addInclude(root, pageInfo.getIncludeCoda()); - } - - Node.Nodes page = new Node.Nodes(root); - return page; - } - - /** - * Attributes ::= (S Attribute)* S? - */ - Attributes parseAttributes() throws JasperException { - AttributesImpl attrs = new AttributesImpl(); - - reader.skipSpaces(); - while (parseAttribute(attrs)) - reader.skipSpaces(); - - return attrs; - } - - /** - * Parse Attributes for a reader, provided for external use - */ - public static Attributes parseAttributes(ParserController pc, - JspReader reader) throws JasperException { - Parser tmpParser = new Parser(pc, reader, false, false, null); - return tmpParser.parseAttributes(); - } - - /** - * Attribute ::= Name S? Eq S? ( '"<%=' RTAttributeValueDouble | '"' - * AttributeValueDouble | "'<%=" RTAttributeValueSingle | "'" - * AttributeValueSingle } Note: JSP and XML spec does not allow while spaces - * around Eq. It is added to be backward compatible with Tomcat, and with - * other xml parsers. - */ - private boolean parseAttribute(AttributesImpl attrs) throws JasperException { - - // Get the qualified name - String qName = parseName(); - if (qName == null) - return false; - - // Determine prefix and local name components - String localName = qName; - String uri = ""; - int index = qName.indexOf(':'); - if (index != -1) { - String prefix = qName.substring(0, index); - uri = pageInfo.getURI(prefix); - if (uri == null) { - err.jspError(reader.mark(), - "jsp.error.attribute.invalidPrefix", prefix); - } - localName = qName.substring(index + 1); - } - - reader.skipSpaces(); - if (!reader.matches("=")) - err.jspError(reader.mark(), "jsp.error.attribute.noequal"); - - reader.skipSpaces(); - char quote = (char) reader.nextChar(); - if (quote != '\'' && quote != '"') - err.jspError(reader.mark(), "jsp.error.attribute.noquote"); - - String watchString = ""; - if (reader.matches("<%=")) - watchString = "%>"; - watchString = watchString + quote; - - String attrValue = parseAttributeValue(watchString); - attrs.addAttribute(uri, localName, qName, "CDATA", attrValue); - return true; - } - - /** - * Name ::= (Letter | '_' | ':') (Letter | Digit | '.' | '_' | '-' | ':')* - */ - private String parseName() throws JasperException { - char ch = (char) reader.peekChar(); - if (Character.isLetter(ch) || ch == '_' || ch == ':') { - StringBuffer buf = new StringBuffer(); - buf.append(ch); - reader.nextChar(); - ch = (char) reader.peekChar(); - while (Character.isLetter(ch) || Character.isDigit(ch) || ch == '.' - || ch == '_' || ch == '-' || ch == ':') { - buf.append(ch); - reader.nextChar(); - ch = (char) reader.peekChar(); - } - return buf.toString(); - } - return null; - } - - /** - * AttributeValueDouble ::= (QuotedChar - '"')* ('"' | ) - * RTAttributeValueDouble ::= ((QuotedChar - '"')* - ((QuotedChar-'"')'%>"') - * ('%>"' | TRANSLATION_ERROR) - */ - private String parseAttributeValue(String watch) throws JasperException { - Mark start = reader.mark(); - Mark stop = reader.skipUntilIgnoreEsc(watch); - if (stop == null) { - err.jspError(start, "jsp.error.attribute.unterminated", watch); - } - - String ret = parseQuoted(start, reader.getText(start, stop), - watch.charAt(watch.length() - 1)); - if (watch.length() == 1) // quote - return ret; - - // putback delimiter '<%=' and '%>', since they are needed if the - // attribute does not allow RTexpression. - return "<%=" + ret + "%>"; - } - - /** - * QuotedChar ::= ''' | '"' | '\\' | '\"' | "\'" | '\>' | '\$' | - * Char - */ - private String parseQuoted(Mark start, String tx, char quote) - throws JasperException { - StringBuffer buf = new StringBuffer(); - int size = tx.length(); - int i = 0; - while (i < size) { - char ch = tx.charAt(i); - if (ch == '&') { - if (i + 5 < size && tx.charAt(i + 1) == 'a' - && tx.charAt(i + 2) == 'p' && tx.charAt(i + 3) == 'o' - && tx.charAt(i + 4) == 's' && tx.charAt(i + 5) == ';') { - buf.append('\''); - i += 6; - } else if (i + 5 < size && tx.charAt(i + 1) == 'q' - && tx.charAt(i + 2) == 'u' && tx.charAt(i + 3) == 'o' - && tx.charAt(i + 4) == 't' && tx.charAt(i + 5) == ';') { - buf.append('"'); - i += 6; - } else { - buf.append(ch); - ++i; - } - } else if (ch == '\\' && i + 1 < size) { - ch = tx.charAt(i + 1); - if (ch == '\\' || ch == '\"' || ch == '\'' || ch == '>') { - // \ " and ' are always unescaped regardless of if they are - // inside or outside of an EL expression. JSP.1.6 takes - // precedence over JSP.1.3.10 (confirmed with EG). - buf.append(ch); - i += 2; - } else { - buf.append('\\'); - ++i; - } - } else if (ch == quote && STRICT_QUOTE_ESCAPING) { - // Unescaped quote character - err.jspError(start, "jsp.error.attribute.noescape", tx, - "" + quote); - } else { - buf.append(ch); - ++i; - } - } - return buf.toString(); - } - - private String parseScriptText(String tx) { - CharArrayWriter cw = new CharArrayWriter(); - int size = tx.length(); - int i = 0; - while (i < size) { - char ch = tx.charAt(i); - if (i + 2 < size && ch == '%' && tx.charAt(i + 1) == '\\' - && tx.charAt(i + 2) == '>') { - cw.write('%'); - cw.write('>'); - i += 3; - } else { - cw.write(ch); - ++i; - } - } - cw.close(); - return cw.toString(); - } - - /* - * Invokes parserController to parse the included page - */ - private void processIncludeDirective(String file, Node parent) - throws JasperException { - if (file == null) { - return; - } - - try { - parserController.parse(file, parent, jarFileUrl); - } catch (FileNotFoundException ex) { - err.jspError(start, "jsp.error.file.not.found", file); - } catch (Exception ex) { - err.jspError(start, ex.getMessage()); - } - } - - /* - * Parses a page directive with the following syntax: PageDirective ::= ( S - * Attribute)* - */ - private void parsePageDirective(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - Node.PageDirective n = new Node.PageDirective(attrs, start, parent); - - /* - * A page directive may contain multiple 'import' attributes, each of - * which consists of a comma-separated list of package names. Store each - * list with the node, where it is parsed. - */ - for (int i = 0; i < attrs.getLength(); i++) { - if ("import".equals(attrs.getQName(i))) { - n.addImport(attrs.getValue(i)); - } - } - } - - /* - * Parses an include directive with the following syntax: IncludeDirective - * ::= ( S Attribute)* - */ - private void parseIncludeDirective(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - - // Included file expanded here - Node includeNode = new Node.IncludeDirective(attrs, start, parent); - processIncludeDirective(attrs.getValue("file"), includeNode); - } - - /** - * Add a list of files. This is used for implementing include-prelude and - * include-coda of jsp-config element in web.xml - */ - private void addInclude(Node parent, List files) throws JasperException { - if (files != null) { - Iterator iter = files.iterator(); - while (iter.hasNext()) { - String file = (String) iter.next(); - AttributesImpl attrs = new AttributesImpl(); - attrs.addAttribute("", "file", "file", "CDATA", file); - - // Create a dummy Include directive node - Node includeNode = new Node.IncludeDirective(attrs, reader - .mark(), parent); - processIncludeDirective(file, includeNode); - } - } - } - - /* - * Parses a taglib directive with the following syntax: Directive ::= ( S - * Attribute)* - */ - private void parseTaglibDirective(Node parent) throws JasperException { - - Attributes attrs = parseAttributes(); - String uri = attrs.getValue("uri"); - String prefix = attrs.getValue("prefix"); - if (prefix != null) { - Mark prevMark = pageInfo.getNonCustomTagPrefix(prefix); - if (prevMark != null) { - err.jspError(reader.mark(), "jsp.error.prefix.use_before_dcl", - prefix, prevMark.getFile(), "" - + prevMark.getLineNumber()); - } - if (uri != null) { - String uriPrev = pageInfo.getURI(prefix); - if (uriPrev != null && !uriPrev.equals(uri)) { - err.jspError(reader.mark(), "jsp.error.prefix.refined", - prefix, uri, uriPrev); - } - if (pageInfo.getTaglib(uri) == null) { - TagLibraryInfoImpl impl = null; - if (ctxt.getOptions().isCaching()) { - impl = (TagLibraryInfoImpl) ctxt.getOptions() - .getCache().get(uri); - } - if (impl == null) { - String[] location = ctxt.getTldLocation(uri); - impl = new TagLibraryInfoImpl(ctxt, parserController, pageInfo, - prefix, uri, location, err); - if (ctxt.getOptions().isCaching()) { - ctxt.getOptions().getCache().put(uri, impl); - } - } else { - // Current compilation context needs location of cached - // tag files - for (TagFileInfo info : impl.getTagFiles()) { - ctxt.setTagFileJarUrl(info.getPath(), - ctxt.getTagFileJarUrl()); - } - } - pageInfo.addTaglib(uri, impl); - } - pageInfo.addPrefixMapping(prefix, uri); - } else { - String tagdir = attrs.getValue("tagdir"); - if (tagdir != null) { - String urnTagdir = URN_JSPTAGDIR + tagdir; - if (pageInfo.getTaglib(urnTagdir) == null) { - pageInfo.addTaglib(urnTagdir, - new ImplicitTagLibraryInfo(ctxt, - parserController, pageInfo, prefix, tagdir, err)); - } - pageInfo.addPrefixMapping(prefix, urnTagdir); - } - } - } - - new Node.TaglibDirective(attrs, start, parent); - } - - /* - * Parses a directive with the following syntax: Directive ::= S? ( 'page' - * PageDirective | 'include' IncludeDirective | 'taglib' TagLibDirective) S? - * '%>' - * - * TagDirective ::= S? ('tag' PageDirective | 'include' IncludeDirective | - * 'taglib' TagLibDirective) | 'attribute AttributeDirective | 'variable - * VariableDirective S? '%>' - */ - private void parseDirective(Node parent) throws JasperException { - reader.skipSpaces(); - - String directive = null; - if (reader.matches("page")) { - directive = "<%@ page"; - if (isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.istagfile", - directive); - } - parsePageDirective(parent); - } else if (reader.matches("include")) { - directive = "<%@ include"; - parseIncludeDirective(parent); - } else if (reader.matches("taglib")) { - if (directivesOnly) { - // No need to get the tagLibInfo objects. This alos suppresses - // parsing of any tag files used in this tag file. - return; - } - directive = "<%@ taglib"; - parseTaglibDirective(parent); - } else if (reader.matches("tag")) { - directive = "<%@ tag"; - if (!isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.isnottagfile", - directive); - } - parseTagDirective(parent); - } else if (reader.matches("attribute")) { - directive = "<%@ attribute"; - if (!isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.isnottagfile", - directive); - } - parseAttributeDirective(parent); - } else if (reader.matches("variable")) { - directive = "<%@ variable"; - if (!isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.isnottagfile", - directive); - } - parseVariableDirective(parent); - } else { - err.jspError(reader.mark(), "jsp.error.invalid.directive"); - } - - reader.skipSpaces(); - if (!reader.matches("%>")) { - err.jspError(start, "jsp.error.unterminated", directive); - } - } - - /* - * Parses a directive with the following syntax: - * - * XMLJSPDirectiveBody ::= S? ( ( 'page' PageDirectiveAttrList S? ( '/>' | ( - * '>' S? ETag ) ) | ( 'include' IncludeDirectiveAttrList S? ( '/>' | ( '>' - * S? ETag ) ) | - * - * XMLTagDefDirectiveBody ::= ( ( 'tag' TagDirectiveAttrList S? ( '/>' | ( - * '>' S? ETag ) ) | ( 'include' IncludeDirectiveAttrList S? ( '/>' | ( '>' - * S? ETag ) ) | ( 'attribute' AttributeDirectiveAttrList S? ( '/>' | ( '>' - * S? ETag ) ) | ( 'variable' VariableDirectiveAttrList S? ( '/>' | ( '>' S? - * ETag ) ) ) | - */ - private void parseXMLDirective(Node parent) throws JasperException { - reader.skipSpaces(); - - String eTag = null; - if (reader.matches("page")) { - eTag = "jsp:directive.page"; - if (isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.istagfile", - "<" + eTag); - } - parsePageDirective(parent); - } else if (reader.matches("include")) { - eTag = "jsp:directive.include"; - parseIncludeDirective(parent); - } else if (reader.matches("tag")) { - eTag = "jsp:directive.tag"; - if (!isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.isnottagfile", - "<" + eTag); - } - parseTagDirective(parent); - } else if (reader.matches("attribute")) { - eTag = "jsp:directive.attribute"; - if (!isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.isnottagfile", - "<" + eTag); - } - parseAttributeDirective(parent); - } else if (reader.matches("variable")) { - eTag = "jsp:directive.variable"; - if (!isTagFile) { - err.jspError(reader.mark(), "jsp.error.directive.isnottagfile", - "<" + eTag); - } - parseVariableDirective(parent); - } else { - err.jspError(reader.mark(), "jsp.error.invalid.directive"); - } - - reader.skipSpaces(); - if (reader.matches(">")) { - reader.skipSpaces(); - if (!reader.matchesETag(eTag)) { - err.jspError(start, "jsp.error.unterminated", "<" + eTag); - } - } else if (!reader.matches("/>")) { - err.jspError(start, "jsp.error.unterminated", "<" + eTag); - } - } - - /* - * Parses a tag directive with the following syntax: PageDirective ::= ( S - * Attribute)* - */ - private void parseTagDirective(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - Node.TagDirective n = new Node.TagDirective(attrs, start, parent); - - /* - * A page directive may contain multiple 'import' attributes, each of - * which consists of a comma-separated list of package names. Store each - * list with the node, where it is parsed. - */ - for (int i = 0; i < attrs.getLength(); i++) { - if ("import".equals(attrs.getQName(i))) { - n.addImport(attrs.getValue(i)); - } - } - } - - /* - * Parses a attribute directive with the following syntax: - * AttributeDirective ::= ( S Attribute)* - */ - private void parseAttributeDirective(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - Node.AttributeDirective n = new Node.AttributeDirective(attrs, start, - parent); - } - - /* - * Parses a variable directive with the following syntax: PageDirective ::= ( - * S Attribute)* - */ - private void parseVariableDirective(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - Node.VariableDirective n = new Node.VariableDirective(attrs, start, - parent); - } - - /* - * JSPCommentBody ::= (Char* - (Char* '--%>')) '--%>' - */ - private void parseComment(Node parent) throws JasperException { - start = reader.mark(); - Mark stop = reader.skipUntil("--%>"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "<%--"); - } - - new Node.Comment(reader.getText(start, stop), start, parent); - } - - /* - * DeclarationBody ::= (Char* - (char* '%>')) '%>' - */ - private void parseDeclaration(Node parent) throws JasperException { - start = reader.mark(); - Mark stop = reader.skipUntil("%>"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "<%!"); - } - - new Node.Declaration(parseScriptText(reader.getText(start, stop)), - start, parent); - } - - /* - * XMLDeclarationBody ::= ( S? '/>' ) | ( S? '>' (Char* - (char* '<')) - * CDSect?)* ETag | CDSect ::= CDStart CData CDEnd - * CDStart ::= '' Char*)) CDEnd - * ::= ']]>' - */ - private void parseXMLDeclaration(Node parent) throws JasperException { - reader.skipSpaces(); - if (!reader.matches("/>")) { - if (!reader.matches(">")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:declaration>"); - } - Mark stop; - String text; - while (true) { - start = reader.mark(); - stop = reader.skipUntil("<"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:declaration>"); - } - text = parseScriptText(reader.getText(start, stop)); - new Node.Declaration(text, start, parent); - if (reader.matches("![CDATA[")) { - start = reader.mark(); - stop = reader.skipUntil("]]>"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "CDATA"); - } - text = parseScriptText(reader.getText(start, stop)); - new Node.Declaration(text, start, parent); - } else { - break; - } - } - - if (!reader.matchesETagWithoutLessThan("jsp:declaration")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:declaration>"); - } - } - } - - /* - * ExpressionBody ::= (Char* - (char* '%>')) '%>' - */ - private void parseExpression(Node parent) throws JasperException { - start = reader.mark(); - Mark stop = reader.skipUntil("%>"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "<%="); - } - - new Node.Expression(parseScriptText(reader.getText(start, stop)), - start, parent); - } - - /* - * XMLExpressionBody ::= ( S? '/>' ) | ( S? '>' (Char* - (char* '<')) - * CDSect?)* ETag ) | - */ - private void parseXMLExpression(Node parent) throws JasperException { - reader.skipSpaces(); - if (!reader.matches("/>")) { - if (!reader.matches(">")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:expression>"); - } - Mark stop; - String text; - while (true) { - start = reader.mark(); - stop = reader.skipUntil("<"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:expression>"); - } - text = parseScriptText(reader.getText(start, stop)); - new Node.Expression(text, start, parent); - if (reader.matches("![CDATA[")) { - start = reader.mark(); - stop = reader.skipUntil("]]>"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "CDATA"); - } - text = parseScriptText(reader.getText(start, stop)); - new Node.Expression(text, start, parent); - } else { - break; - } - } - if (!reader.matchesETagWithoutLessThan("jsp:expression")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:expression>"); - } - } - } - - /* - * ELExpressionBody (following "${" to first unquoted "}") // XXX add formal - * production and confirm implementation against it, // once it's decided - */ - private void parseELExpression(Node parent, char type) throws JasperException { - start = reader.mark(); - Mark last = null; - boolean singleQuoted = false, doubleQuoted = false; - int currentChar; - do { - // XXX could move this logic to JspReader - last = reader.mark(); // XXX somewhat wasteful - currentChar = reader.nextChar(); - if (currentChar == '\\' && (singleQuoted || doubleQuoted)) { - // skip character following '\' within quotes - reader.nextChar(); - currentChar = reader.nextChar(); - } - if (currentChar == -1) - err.jspError(start, "jsp.error.unterminated", type + "{"); - if (currentChar == '"' && !singleQuoted) - doubleQuoted = !doubleQuoted; - if (currentChar == '\'' && !doubleQuoted) - singleQuoted = !singleQuoted; - } while (currentChar != '}' || (singleQuoted || doubleQuoted)); - - new Node.ELExpression(type, reader.getText(start, last), start, parent); - } - - /* - * ScriptletBody ::= (Char* - (char* '%>')) '%>' - */ - private void parseScriptlet(Node parent) throws JasperException { - start = reader.mark(); - Mark stop = reader.skipUntil("%>"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "<%"); - } - - new Node.Scriptlet(parseScriptText(reader.getText(start, stop)), start, - parent); - } - - /* - * XMLScriptletBody ::= ( S? '/>' ) | ( S? '>' (Char* - (char* '<')) - * CDSect?)* ETag ) | - */ - private void parseXMLScriptlet(Node parent) throws JasperException { - reader.skipSpaces(); - if (!reader.matches("/>")) { - if (!reader.matches(">")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:scriptlet>"); - } - Mark stop; - String text; - while (true) { - start = reader.mark(); - stop = reader.skipUntil("<"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:scriptlet>"); - } - text = parseScriptText(reader.getText(start, stop)); - new Node.Scriptlet(text, start, parent); - if (reader.matches("![CDATA[")) { - start = reader.mark(); - stop = reader.skipUntil("]]>"); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "CDATA"); - } - text = parseScriptText(reader.getText(start, stop)); - new Node.Scriptlet(text, start, parent); - } else { - break; - } - } - - if (!reader.matchesETagWithoutLessThan("jsp:scriptlet")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:scriptlet>"); - } - } - } - - /** - * Param ::= '' S? ( ' ) S? ETag ) | ( '>' S? Param* ETag ) - * - * EmptyBody ::= '/>' | ( '>' ETag ) | ( '>' S? '' Param* '' - */ - private void parseInclude(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - Node includeNode = new Node.IncludeAction(attrs, start, parent); - - parseOptionalBody(includeNode, "jsp:include", JAVAX_BODY_CONTENT_PARAM); - } - - /* - * For Forward: StdActionContent ::= Attributes ParamBody - */ - private void parseForward(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - Node forwardNode = new Node.ForwardAction(attrs, start, parent); - - parseOptionalBody(forwardNode, "jsp:forward", JAVAX_BODY_CONTENT_PARAM); - } - - private void parseInvoke(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - Node invokeNode = new Node.InvokeAction(attrs, start, parent); - - parseEmptyBody(invokeNode, "jsp:invoke"); - } - - private void parseDoBody(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - Node doBodyNode = new Node.DoBodyAction(attrs, start, parent); - - parseEmptyBody(doBodyNode, "jsp:doBody"); - } - - private void parseElement(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - Node elementNode = new Node.JspElement(attrs, start, parent); - - parseOptionalBody(elementNode, "jsp:element", TagInfo.BODY_CONTENT_JSP); - } - - /* - * For GetProperty: StdActionContent ::= Attributes EmptyBody - */ - private void parseGetProperty(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - Node getPropertyNode = new Node.GetProperty(attrs, start, parent); - - parseOptionalBody(getPropertyNode, "jsp:getProperty", - TagInfo.BODY_CONTENT_EMPTY); - } - - /* - * For SetProperty: StdActionContent ::= Attributes EmptyBody - */ - private void parseSetProperty(Node parent) throws JasperException { - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - Node setPropertyNode = new Node.SetProperty(attrs, start, parent); - - parseOptionalBody(setPropertyNode, "jsp:setProperty", - TagInfo.BODY_CONTENT_EMPTY); - } - - /* - * EmptyBody ::= '/>' | ( '>' ETag ) | ( '>' S? '")) { - // Done - } else if (reader.matches(">")) { - if (reader.matchesETag(tag)) { - // Done - } else if (reader.matchesOptionalSpacesFollowedBy("' ETag ) | ( '>' S? '' Body ETag ) - * - * ScriptlessActionBody ::= JspAttributeAndBody | ( '>' ScriptlessBody ETag ) - * - * TagDependentActionBody ::= JspAttributeAndBody | ( '>' TagDependentBody - * ETag ) - * - */ - private void parseOptionalBody(Node parent, String tag, String bodyType) - throws JasperException { - if (reader.matches("/>")) { - // EmptyBody - return; - } - - if (!reader.matches(">")) { - err.jspError(reader.mark(), "jsp.error.unterminated", "<" + tag); - } - - if (reader.matchesETag(tag)) { - // EmptyBody - return; - } - - if (!parseJspAttributeAndBody(parent, tag, bodyType)) { - // Must be ( '>' # Body ETag ) - parseBody(parent, tag, bodyType); - } - } - - /** - * Attempts to parse 'JspAttributeAndBody' production. Returns true if it - * matched, or false if not. Assumes EmptyBody is okay as well. - * - * JspAttributeAndBody ::= ( '>' # S? ( ' ) S? ETag ) - */ - private boolean parseJspAttributeAndBody(Node parent, String tag, - String bodyType) throws JasperException { - boolean result = false; - - if (reader.matchesOptionalSpacesFollowedBy(" elements: - parseNamedAttributes(parent); - - result = true; - } - - if (reader.matchesOptionalSpacesFollowedBy(" but something other than - // or the end tag, translation error. - err.jspError(reader.mark(), "jsp.error.jspbody.required", "<" - + tag); - } - - return result; - } - - /* - * Params ::= `>' S? ( ( `' ( ( S? Param+ S? `' ) | - * ) ) | Param+ ) '' - */ - private void parseJspParams(Node parent) throws JasperException { - Node jspParamsNode = new Node.ParamsAction(start, parent); - parseOptionalBody(jspParamsNode, "jsp:params", JAVAX_BODY_CONTENT_PARAM); - } - - /* - * Fallback ::= '/>' | ( `>' S? `' ( ( S? ( Char* - ( Char* `' ) ) `' - * S? ) | ) `' ) | ( '>' ( Char* - ( - * Char* '' ) ) '' ) - */ - private void parseFallBack(Node parent) throws JasperException { - Node fallBackNode = new Node.FallBackAction(start, parent); - parseOptionalBody(fallBackNode, "jsp:fallback", - JAVAX_BODY_CONTENT_TEMPLATE_TEXT); - } - - /* - * For Plugin: StdActionContent ::= Attributes PluginBody - * - * PluginBody ::= EmptyBody | ( '>' S? ( ' ) S? ETag ) | ( '>' S? PluginTags - * ETag ) - * - * EmptyBody ::= '/>' | ( '>' ETag ) | ( '>' S? ' - * - * Attributes ::= ( S Attribute )* S? - * - * CustomActionEnd ::= CustomActionTagDependent | CustomActionJSPContent | - * CustomActionScriptlessContent - * - * CustomActionTagDependent ::= TagDependentOptionalBody - * - * CustomActionJSPContent ::= OptionalBody - * - * CustomActionScriptlessContent ::= ScriptlessOptionalBody - */ - private boolean parseCustomTag(Node parent) throws JasperException { - - if (reader.peekChar() != '<') { - return false; - } - - // Parse 'CustomAction' production (tag prefix and custom action name) - reader.nextChar(); // skip '<' - String tagName = reader.parseToken(false); - int i = tagName.indexOf(':'); - if (i == -1) { - reader.reset(start); - return false; - } - - String prefix = tagName.substring(0, i); - String shortTagName = tagName.substring(i + 1); - - // Check if this is a user-defined tag. - String uri = pageInfo.getURI(prefix); - if (uri == null) { - reader.reset(start); - // Remember the prefix for later error checking - pageInfo.putNonCustomTagPrefix(prefix, reader.mark()); - return false; - } - - TagLibraryInfo tagLibInfo = pageInfo.getTaglib(uri); - TagInfo tagInfo = tagLibInfo.getTag(shortTagName); - TagFileInfo tagFileInfo = tagLibInfo.getTagFile(shortTagName); - if (tagInfo == null && tagFileInfo == null) { - err.jspError(start, "jsp.error.bad_tag", shortTagName, prefix); - } - Class tagHandlerClass = null; - if (tagInfo != null) { - // Must be a classic tag, load it here. - // tag files will be loaded later, in TagFileProcessor - String handlerClassName = tagInfo.getTagClassName(); - try { - tagHandlerClass = ctxt.getClassLoader().loadClass( - handlerClassName); - } catch (Exception e) { - err.jspError(start, "jsp.error.loadclass.taghandler", - handlerClassName, tagName); - } - } - - // Parse 'CustomActionBody' production: - // At this point we are committed - if anything fails, we produce - // a translation error. - - // Parse 'Attributes' production: - Attributes attrs = parseAttributes(); - reader.skipSpaces(); - - // Parse 'CustomActionEnd' production: - if (reader.matches("/>")) { - if (tagInfo != null) { - new Node.CustomTag(tagName, prefix, shortTagName, uri, attrs, - start, parent, tagInfo, tagHandlerClass); - } else { - new Node.CustomTag(tagName, prefix, shortTagName, uri, attrs, - start, parent, tagFileInfo); - } - return true; - } - - // Now we parse one of 'CustomActionTagDependent', - // 'CustomActionJSPContent', or 'CustomActionScriptlessContent'. - // depending on body-content in TLD. - - // Looking for a body, it still can be empty; but if there is a - // a tag body, its syntax would be dependent on the type of - // body content declared in the TLD. - String bc; - if (tagInfo != null) { - bc = tagInfo.getBodyContent(); - } else { - bc = tagFileInfo.getTagInfo().getBodyContent(); - } - - Node tagNode = null; - if (tagInfo != null) { - tagNode = new Node.CustomTag(tagName, prefix, shortTagName, uri, - attrs, start, parent, tagInfo, tagHandlerClass); - } else { - tagNode = new Node.CustomTag(tagName, prefix, shortTagName, uri, - attrs, start, parent, tagFileInfo); - } - - parseOptionalBody(tagNode, tagName, bc); - - return true; - } - - /* - * Parse for a template text string until '<' or "${" or "#{" is encountered, - * recognizing escape sequences "\%", "\$", and "\#". - */ - private void parseTemplateText(Node parent) throws JasperException { - - if (!reader.hasMoreInput()) - return; - - CharArrayWriter ttext = new CharArrayWriter(); - // Output the first character - int ch = reader.nextChar(); - if (ch == '\\') { - reader.pushChar(); - } else { - ttext.write(ch); - } - - while (reader.hasMoreInput()) { - ch = reader.nextChar(); - if (ch == '<') { - reader.pushChar(); - break; - } else if ((ch == '$' || ch == '#') && !pageInfo.isELIgnored()) { - if (!reader.hasMoreInput()) { - ttext.write(ch); - break; - } - if (reader.nextChar() == '{') { - reader.pushChar(); - reader.pushChar(); - break; - } - ttext.write(ch); - reader.pushChar(); - continue; - } else if (ch == '\\') { - if (!reader.hasMoreInput()) { - ttext.write('\\'); - break; - } - char next = (char) reader.peekChar(); - // Looking for \% or \$ or \# - if (next == '%' || ((next == '$' || next == '#') && - !pageInfo.isELIgnored())) { - ch = reader.nextChar(); - } - } - ttext.write(ch); - } - new Node.TemplateText(ttext.toString(), start, parent); - } - - /* - * XMLTemplateText ::= ( S? '/>' ) | ( S? '>' ( ( Char* - ( Char* ( '<' | - * '${' ) ) ) ( '${' ELExpressionBody )? CDSect? )* ETag ) | - * - */ - private void parseXMLTemplateText(Node parent) throws JasperException { - reader.skipSpaces(); - if (!reader.matches("/>")) { - if (!reader.matches(">")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:text>"); - } - CharArrayWriter ttext = new CharArrayWriter(); - while (reader.hasMoreInput()) { - int ch = reader.nextChar(); - if (ch == '<') { - // Check for "); - if (stop == null) { - err.jspError(start, "jsp.error.unterminated", "CDATA"); - } - String text = reader.getText(start, stop); - ttext.write(text, 0, text.length()); - } else if (ch == '\\') { - if (!reader.hasMoreInput()) { - ttext.write('\\'); - break; - } - ch = reader.nextChar(); - if (ch != '$' && ch != '#') { - ttext.write('\\'); - } - ttext.write(ch); - } else if (ch == '$' || ch == '#') { - if (!reader.hasMoreInput()) { - ttext.write(ch); - break; - } - if (reader.nextChar() != '{') { - ttext.write(ch); - reader.pushChar(); - continue; - } - // Create a template text node - new Node.TemplateText(ttext.toString(), start, parent); - - // Mark and parse the EL expression and create its node: - start = reader.mark(); - parseELExpression(parent, (char) ch); - - start = reader.mark(); - ttext = new CharArrayWriter(); - } else { - ttext.write(ch); - } - } - - new Node.TemplateText(ttext.toString(), start, parent); - - if (!reader.hasMoreInput()) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:text>"); - } else if (!reader.matchesETagWithoutLessThan("jsp:text")) { - err.jspError(start, "jsp.error.jsptext.badcontent"); - } - } - } - - /* - * AllBody ::= ( '<%--' JSPCommentBody ) | ( '<%@' DirectiveBody ) | ( ' 0) { - // vc: ScriptlessBody - // We must follow the ScriptlessBody production if one of - // our parents is ScriptlessBody. - parseElementsScriptless(parent); - return; - } - - start = reader.mark(); - if (reader.matches("<%--")) { - parseComment(parent); - } else if (reader.matches("<%@")) { - parseDirective(parent); - } else if (reader.matches(" ) | ( ' ) | ( '<%=' ) | ( ' ) | ( '<%' ) | ( ' ) | ( ' ) | ( ' ) | ( '<%=' ) | ( ' ) | ( '<%' ) | ( ' ) | ( ' ) | ( '${' - * ) | ( ' ) | TemplateText - */ - private void parseElementsTemplateText(Node parent) throws JasperException { - start = reader.mark(); - if (reader.matches("<%--")) { - parseComment(parent); - } else if (reader.matches("<%@")) { - parseDirective(parent); - } else if (reader.matches("")) { - if (!reader.matches(">")) { - err.jspError(start, "jsp.error.unterminated", "<jsp:body"); - } - parseBody(bodyNode, "jsp:body", bodyType); - } - } - - /* - * Parse the body as JSP content. @param tag The name of the tag whose end - * tag would terminate the body @param bodyType One of the TagInfo body - * types - */ - private void parseBody(Node parent, String tag, String bodyType) - throws JasperException { - if (bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_TAG_DEPENDENT)) { - parseTagDependentBody(parent, tag); - } else if (bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_EMPTY)) { - if (!reader.matchesETag(tag)) { - err.jspError(start, "jasper.error.emptybodycontent.nonempty", - tag); - } - } else if (bodyType == JAVAX_BODY_CONTENT_PLUGIN) { - // (note the == since we won't recognize JAVAX_* - // from outside this module). - parsePluginTags(parent); - if (!reader.matchesETag(tag)) { - err.jspError(reader.mark(), "jsp.error.unterminated", "<" - + tag); - } - } else if (bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_JSP) - || bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_SCRIPTLESS) - || (bodyType == JAVAX_BODY_CONTENT_PARAM) - || (bodyType == JAVAX_BODY_CONTENT_TEMPLATE_TEXT)) { - while (reader.hasMoreInput()) { - if (reader.matchesETag(tag)) { - return; - } - - // Check for nested jsp:body or jsp:attribute - if (tag.equals("jsp:body") || tag.equals("jsp:attribute")) { - if (reader.matches("")) { - if (!reader.matches(">")) { - err.jspError(start, "jsp.error.unterminated", - "<jsp:attribute"); - } - if (namedAttributeNode.isTrim()) { - reader.skipSpaces(); - } - parseBody(namedAttributeNode, "jsp:attribute", - getAttributeBodyType(parent, attrs.getValue("name"))); - if (namedAttributeNode.isTrim()) { - Node.Nodes subElems = namedAttributeNode.getBody(); - if (subElems != null) { - Node lastNode = subElems.getNode(subElems.size() - 1); - if (lastNode instanceof Node.TemplateText) { - ((Node.TemplateText) lastNode).rtrim(); - } - } - } - } - reader.skipSpaces(); - } while (reader.matches(" from the enclosing node - */ - private String getAttributeBodyType(Node n, String name) { - - if (n instanceof Node.CustomTag) { - TagInfo tagInfo = ((Node.CustomTag) n).getTagInfo(); - TagAttributeInfo[] tldAttrs = tagInfo.getAttributes(); - for (int i = 0; i < tldAttrs.length; i++) { - if (name.equals(tldAttrs[i].getName())) { - if (tldAttrs[i].isFragment()) { - return TagInfo.BODY_CONTENT_SCRIPTLESS; - } - if (tldAttrs[i].canBeRequestTime()) { - return TagInfo.BODY_CONTENT_JSP; - } - } - } - if (tagInfo.hasDynamicAttributes()) { - return TagInfo.BODY_CONTENT_JSP; - } - } else if (n instanceof Node.IncludeAction) { - if ("page".equals(name)) { - return TagInfo.BODY_CONTENT_JSP; - } - } else if (n instanceof Node.ForwardAction) { - if ("page".equals(name)) { - return TagInfo.BODY_CONTENT_JSP; - } - } else if (n instanceof Node.SetProperty) { - if ("value".equals(name)) { - return TagInfo.BODY_CONTENT_JSP; - } - } else if (n instanceof Node.UseBean) { - if ("beanName".equals(name)) { - return TagInfo.BODY_CONTENT_JSP; - } - } else if (n instanceof Node.PlugIn) { - if ("width".equals(name) || "height".equals(name)) { - return TagInfo.BODY_CONTENT_JSP; - } - } else if (n instanceof Node.ParamAction) { - if ("value".equals(name)) { - return TagInfo.BODY_CONTENT_JSP; - } - } else if (n instanceof Node.JspElement) { - return TagInfo.BODY_CONTENT_JSP; - } - - return JAVAX_BODY_CONTENT_TEMPLATE_TEXT; - } - - private void parseTagFileDirectives(Node parent) throws JasperException { - reader.setSingleFile(true); - reader.skipUntil("<"); - while (reader.hasMoreInput()) { - start = reader.mark(); - if (reader.matches("%--")) { - parseComment(parent); - } else if (reader.matches("%@")) { - parseDirective(parent); - } else if (reader.matches("jsp:directive.")) { - parseXMLDirective(parent); - } - reader.skipUntil("<"); - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ParserController.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ParserController.java deleted file mode 100644 index 817fd7af4..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ParserController.java +++ /dev/null @@ -1,638 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.FileNotFoundException; -import java.io.IOException; -import java.io.InputStreamReader; -import java.net.JarURLConnection; -import java.net.URL; -import java.util.Stack; -import java.util.jar.JarFile; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.xmlparser.XMLEncodingDetector; -import org.xml.sax.Attributes; - -/** - * Controller for the parsing of a JSP page. - *

- * The same ParserController instance is used for a JSP page and any JSP - * segments included by it (via an include directive), where each segment may - * be provided in standard or XML syntax. This class selects and invokes the - * appropriate parser for the JSP page and its included segments. - * - * @author Pierre Delisle - * @author Jan Luehe - */ -class ParserController implements TagConstants { - - private static final String CHARSET = "charset="; - - private JspCompilationContext ctxt; - private Compiler compiler; - private ErrorDispatcher err; - - /* - * Indicates the syntax (XML or standard) of the file being processed - */ - private boolean isXml; - - /* - * A stack to keep track of the 'current base directory' - * for include directives that refer to relative paths. - */ - private Stack baseDirStack = new Stack(); - - private boolean isEncodingSpecifiedInProlog; - private boolean isBomPresent; - private int skip; - - private String sourceEnc; - - private boolean isDefaultPageEncoding; - private boolean isTagFile; - private boolean directiveOnly; - - /* - * Constructor - */ - public ParserController(JspCompilationContext ctxt, Compiler compiler) { - this.ctxt = ctxt; - this.compiler = compiler; - this.err = compiler.getErrorDispatcher(); - } - - public JspCompilationContext getJspCompilationContext () { - return ctxt; - } - - public Compiler getCompiler () { - return compiler; - } - - /** - * Parses a JSP page or tag file. This is invoked by the compiler. - * - * @param inFileName The path to the JSP page or tag file to be parsed. - */ - public Node.Nodes parse(String inFileName) - throws FileNotFoundException, JasperException, IOException { - // If we're parsing a packaged tag file or a resource included by it - // (using an include directive), ctxt.getTagFileJar() returns the - // JAR file from which to read the tag file or included resource, - // respectively. - isTagFile = ctxt.isTagFile(); - directiveOnly = false; - return doParse(inFileName, null, ctxt.getTagFileJarUrl()); - } - - /** - * Parses the directives of a JSP page or tag file. This is invoked by the - * compiler. - * - * @param inFileName The path to the JSP page or tag file to be parsed. - */ - public Node.Nodes parseDirectives(String inFileName) - throws FileNotFoundException, JasperException, IOException { - // If we're parsing a packaged tag file or a resource included by it - // (using an include directive), ctxt.getTagFileJar() returns the - // JAR file from which to read the tag file or included resource, - // respectively. - isTagFile = ctxt.isTagFile(); - directiveOnly = true; - return doParse(inFileName, null, ctxt.getTagFileJarUrl()); - } - - - /** - * Processes an include directive with the given path. - * - * @param inFileName The path to the resource to be included. - * @param parent The parent node of the include directive. - * @param jarFile The JAR file from which to read the included resource, - * or null of the included resource is to be read from the filesystem - */ - public Node.Nodes parse(String inFileName, Node parent, - URL jarFileUrl) - throws FileNotFoundException, JasperException, IOException { - // For files that are statically included, isTagfile and directiveOnly - // remain unchanged. - return doParse(inFileName, parent, jarFileUrl); - } - - /** - * Extracts tag file directive information from the tag file with the - * given name. - * - * This is invoked by the compiler - * - * @param inFileName The name of the tag file to be parsed. - * @deprecated Use {@link #parseTagFileDirectives(String, URL)} - * See https://issues.apache.org/bugzilla/show_bug.cgi?id=46471 - */ - public Node.Nodes parseTagFileDirectives(String inFileName) - throws FileNotFoundException, JasperException, IOException { - return parseTagFileDirectives( - inFileName, ctxt.getTagFileJarUrl(inFileName)); - } - - /** - * Extracts tag file directive information from the given tag file. - * - * This is invoked by the compiler - * - * @param inFileName The name of the tag file to be parsed. - * @param tagFileJarUrl The location of the tag file. - */ - public Node.Nodes parseTagFileDirectives(String inFileName, - URL tagFileJarUrl) - throws FileNotFoundException, JasperException, IOException { - boolean isTagFileSave = isTagFile; - boolean directiveOnlySave = directiveOnly; - isTagFile = true; - directiveOnly = true; - Node.Nodes page = doParse(inFileName, null, tagFileJarUrl); - directiveOnly = directiveOnlySave; - isTagFile = isTagFileSave; - return page; - } - - /** - * Parses the JSP page or tag file with the given path name. - * - * @param inFileName The name of the JSP page or tag file to be parsed. - * @param parent The parent node (non-null when processing an include - * directive) - * @param isTagFile true if file to be parsed is tag file, and false if it - * is a regular JSP page - * @param directivesOnly true if the file to be parsed is a tag file and - * we are only interested in the directives needed for constructing a - * TagFileInfo. - * @param jarFile The JAR file from which to read the JSP page or tag file, - * or null if the JSP page or tag file is to be read from the filesystem - */ - private Node.Nodes doParse(String inFileName, - Node parent, - URL jarFileUrl) - throws FileNotFoundException, JasperException, IOException { - - Node.Nodes parsedPage = null; - isEncodingSpecifiedInProlog = false; - isBomPresent = false; - isDefaultPageEncoding = false; - - JarFile jarFile = getJarFile(jarFileUrl); - String absFileName = resolveFileName(inFileName); - String jspConfigPageEnc = getJspConfigPageEncoding(absFileName); - - // Figure out what type of JSP document and encoding type we are - // dealing with - determineSyntaxAndEncoding(absFileName, jarFile, jspConfigPageEnc); - - if (parent != null) { - // Included resource, add to dependent list - if (jarFile == null) { - compiler.getPageInfo().addDependant(absFileName); - } else { - compiler.getPageInfo().addDependant( - jarFileUrl.toExternalForm() + absFileName.substring(1)); - } - } - - if ((isXml && isEncodingSpecifiedInProlog) || isBomPresent) { - /* - * Make sure the encoding explicitly specified in the XML - * prolog (if any) matches that in the JSP config element - * (if any), treating "UTF-16", "UTF-16BE", and "UTF-16LE" as - * identical. - */ - if (jspConfigPageEnc != null && !jspConfigPageEnc.equals(sourceEnc) - && (!jspConfigPageEnc.startsWith("UTF-16") - || !sourceEnc.startsWith("UTF-16"))) { - err.jspError("jsp.error.prolog_config_encoding_mismatch", - sourceEnc, jspConfigPageEnc); - } - } - - // Dispatch to the appropriate parser - if (isXml) { - // JSP document (XML syntax) - // InputStream for jspx page is created and properly closed in - // JspDocumentParser. - parsedPage = JspDocumentParser.parse(this, absFileName, - jarFile, parent, - isTagFile, directiveOnly, - sourceEnc, - jspConfigPageEnc, - isEncodingSpecifiedInProlog, - isBomPresent); - } else { - // Standard syntax - InputStreamReader inStreamReader = null; - try { - inStreamReader = JspUtil.getReader(absFileName, sourceEnc, - jarFile, ctxt, err, skip); - JspReader jspReader = new JspReader(ctxt, absFileName, - sourceEnc, inStreamReader, - err); - parsedPage = Parser.parse(this, jspReader, parent, isTagFile, - directiveOnly, jarFileUrl, - sourceEnc, jspConfigPageEnc, - isDefaultPageEncoding, isBomPresent); - } finally { - if (inStreamReader != null) { - try { - inStreamReader.close(); - } catch (Exception any) { - } - } - } - } - - if (jarFile != null) { - try { - jarFile.close(); - } catch (Throwable t) {} - } - - baseDirStack.pop(); - - return parsedPage; - } - - /* - * Checks to see if the given URI is matched by a URL pattern specified in - * a jsp-property-group in web.xml, and if so, returns the value of the - * element. - * - * @param absFileName The URI to match - * - * @return The value of the attribute of the - * jsp-property-group with matching URL pattern - */ - private String getJspConfigPageEncoding(String absFileName) - throws JasperException { - - JspConfig jspConfig = ctxt.getOptions().getJspConfig(); - JspConfig.JspProperty jspProperty - = jspConfig.findJspProperty(absFileName); - return jspProperty.getPageEncoding(); - } - - /** - * Determines the syntax (standard or XML) and page encoding properties - * for the given file, and stores them in the 'isXml' and 'sourceEnc' - * instance variables, respectively. - */ - private void determineSyntaxAndEncoding(String absFileName, - JarFile jarFile, - String jspConfigPageEnc) - throws JasperException, IOException { - - isXml = false; - - /* - * 'true' if the syntax (XML or standard) of the file is given - * from external information: either via a JSP configuration element, - * the ".jspx" suffix, or the enclosing file (for included resources) - */ - boolean isExternal = false; - - /* - * Indicates whether we need to revert from temporary usage of - * "ISO-8859-1" back to "UTF-8" - */ - boolean revert = false; - - JspConfig jspConfig = ctxt.getOptions().getJspConfig(); - JspConfig.JspProperty jspProperty = jspConfig.findJspProperty( - absFileName); - if (jspProperty.isXml() != null) { - // If is specified in a , it is used. - isXml = JspUtil.booleanValue(jspProperty.isXml()); - isExternal = true; - } else if (absFileName.endsWith(".jspx") - || absFileName.endsWith(".tagx")) { - isXml = true; - isExternal = true; - } - - if (isExternal && !isXml) { - // JSP (standard) syntax. Use encoding specified in jsp-config - // if provided. - sourceEnc = jspConfigPageEnc; - if (sourceEnc != null) { - return; - } - // We don't know the encoding, so use BOM to determine it - sourceEnc = "ISO-8859-1"; - } else { - // XML syntax or unknown, (auto)detect encoding ... - Object[] ret = XMLEncodingDetector.getEncoding(absFileName, - jarFile, ctxt, err); - sourceEnc = (String) ret[0]; - if (((Boolean) ret[1]).booleanValue()) { - isEncodingSpecifiedInProlog = true; - } - if (((Boolean) ret[2]).booleanValue()) { - isBomPresent = true; - } - skip = ((Integer) ret[3]).intValue(); - - if (!isXml && sourceEnc.equals("UTF-8")) { - /* - * We don't know if we're dealing with XML or standard syntax. - * Therefore, we need to check to see if the page contains - * a element. - * - * We need to be careful, because the page may be encoded in - * ISO-8859-1 (or something entirely different), and may - * contain byte sequences that will cause a UTF-8 converter to - * throw exceptions. - * - * It is safe to use a source encoding of ISO-8859-1 in this - * case, as there are no invalid byte sequences in ISO-8859-1, - * and the byte/character sequences we're looking for (i.e., - * ) are identical in either encoding (both UTF-8 - * and ISO-8859-1 are extensions of ASCII). - */ - sourceEnc = "ISO-8859-1"; - revert = true; - } - } - - if (isXml) { - // (This implies 'isExternal' is TRUE.) - // We know we're dealing with a JSP document (via JSP config or - // ".jspx" suffix), so we're done. - return; - } - - /* - * At this point, 'isExternal' or 'isXml' is FALSE. - * Search for jsp:root action, in order to determine if we're dealing - * with XML or standard syntax (unless we already know what we're - * dealing with, i.e., when 'isExternal' is TRUE and 'isXml' is FALSE). - * No check for XML prolog, since nothing prevents a page from - * outputting XML and still using JSP syntax (in this case, the - * XML prolog is treated as template text). - */ - JspReader jspReader = null; - try { - jspReader = new JspReader(ctxt, absFileName, sourceEnc, jarFile, - err); - } catch (FileNotFoundException ex) { - throw new JasperException(ex); - } - jspReader.setSingleFile(true); - Mark startMark = jspReader.mark(); - if (!isExternal) { - jspReader.reset(startMark); - if (hasJspRoot(jspReader)) { - if (revert) { - sourceEnc = "UTF-8"; - } - isXml = true; - return; - } else { - if (revert && isBomPresent) { - sourceEnc = "UTF-8"; - } - isXml = false; - } - } - - /* - * At this point, we know we're dealing with JSP syntax. - * If an XML prolog is provided, it's treated as template text. - * Determine the page encoding from the page directive, unless it's - * specified via JSP config. - */ - if (!isBomPresent) { - sourceEnc = jspConfigPageEnc; - if (sourceEnc == null) { - sourceEnc = getPageEncodingForJspSyntax(jspReader, startMark); - if (sourceEnc == null) { - // Default to "ISO-8859-1" per JSP spec - sourceEnc = "ISO-8859-1"; - isDefaultPageEncoding = true; - } - } - } - - } - - /* - * Determines page source encoding for page or tag file in JSP syntax, - * by reading (in this order) the value of the 'pageEncoding' page - * directive attribute, or the charset value of the 'contentType' page - * directive attribute. - * - * @return The page encoding, or null if not found - */ - private String getPageEncodingForJspSyntax(JspReader jspReader, - Mark startMark) - throws JasperException { - - String encoding = null; - String saveEncoding = null; - - jspReader.reset(startMark); - - /* - * Determine page encoding from directive of the form <%@ page %>, - * <%@ tag %>, or . - */ - while (true) { - if (jspReader.skipUntil("<") == null) { - break; - } - // If this is a comment, skip until its end - if (jspReader.matches("%--")) { - if (jspReader.skipUntil("--%>") == null) { - // error will be caught in Parser - break; - } - continue; - } - boolean isDirective = jspReader.matches("%@"); - if (isDirective) { - jspReader.skipSpaces(); - } - else { - isDirective = jspReader.matches("jsp:directive."); - } - if (!isDirective) { - continue; - } - - // compare for "tag ", so we don't match "taglib" - if (jspReader.matches("tag ") || jspReader.matches("page")) { - - jspReader.skipSpaces(); - Attributes attrs = Parser.parseAttributes(this, jspReader); - encoding = getPageEncodingFromDirective(attrs, "pageEncoding"); - if (encoding != null) { - break; - } - encoding = getPageEncodingFromDirective(attrs, "contentType"); - if (encoding != null) { - saveEncoding = encoding; - } - } - } - - if (encoding == null) { - encoding = saveEncoding; - } - - return encoding; - } - - /* - * Scans the given attributes for the attribute with the given name, - * which is either 'pageEncoding' or 'contentType', and returns the - * specified page encoding. - * - * In the case of 'contentType', the page encoding is taken from the - * content type's 'charset' component. - * - * @param attrs The page directive attributes - * @param attrName The name of the attribute to search for (either - * 'pageEncoding' or 'contentType') - * - * @return The page encoding, or null - */ - private String getPageEncodingFromDirective(Attributes attrs, - String attrName) { - String value = attrs.getValue(attrName); - if (attrName.equals("pageEncoding")) { - return value; - } - - // attrName = contentType - String contentType = value; - String encoding = null; - if (contentType != null) { - int loc = contentType.indexOf(CHARSET); - if (loc != -1) { - encoding = contentType.substring(loc + CHARSET.length()); - } - } - - return encoding; - } - - /* - * Resolve the name of the file and update baseDirStack() to keep track of - * the current base directory for each included file. - * The 'root' file is always an 'absolute' path, so no need to put an - * initial value in the baseDirStack. - */ - private String resolveFileName(String inFileName) { - String fileName = inFileName.replace('\\', '/'); - boolean isAbsolute = fileName.startsWith("/"); - fileName = isAbsolute ? fileName - : (String) baseDirStack.peek() + fileName; - String baseDir = - fileName.substring(0, fileName.lastIndexOf("/") + 1); - baseDirStack.push(baseDir); - return fileName; - } - - /* - * Checks to see if the given page contains, as its first element, a - * element whose prefix is bound to the JSP namespace, as in: - * - * - * ... - * - * - * @param reader The reader for this page - * - * @return true if this page contains a root element whose prefix is bound - * to the JSP namespace, and false otherwise - */ - private boolean hasJspRoot(JspReader reader) throws JasperException { - - // :root must be the first element - Mark start = null; - while ((start = reader.skipUntil("<")) != null) { - int c = reader.nextChar(); - if (c != '!' && c != '?') break; - } - if (start == null) { - return false; - } - Mark stop = reader.skipUntil(":root"); - if (stop == null) { - return false; - } - // call substring to get rid of leading '<' - String prefix = reader.getText(start, stop).substring(1); - - start = stop; - stop = reader.skipUntil(">"); - if (stop == null) { - return false; - } - - // Determine namespace associated with element's prefix - String root = reader.getText(start, stop); - String xmlnsDecl = "xmlns:" + prefix; - int index = root.indexOf(xmlnsDecl); - if (index == -1) { - return false; - } - index += xmlnsDecl.length(); - while (index < root.length() - && Character.isWhitespace(root.charAt(index))) { - index++; - } - if (index < root.length() && root.charAt(index) == '=') { - index++; - while (index < root.length() - && Character.isWhitespace(root.charAt(index))) { - index++; - } - if (index < root.length() && root.charAt(index++) == '"' - && root.regionMatches(index, JSP_URI, 0, - JSP_URI.length())) { - return true; - } - } - - return false; - } - - private JarFile getJarFile(URL jarFileUrl) throws IOException { - JarFile jarFile = null; - - if (jarFileUrl != null) { - JarURLConnection conn = (JarURLConnection) jarFileUrl.openConnection(); - conn.setUseCaches(false); - conn.connect(); - jarFile = conn.getJarFile(); - } - - return jarFile; - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ScriptingVariabler.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ScriptingVariabler.java deleted file mode 100644 index 7110356c9..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ScriptingVariabler.java +++ /dev/null @@ -1,148 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.util.*; -import javax.servlet.jsp.tagext.*; -import org.apache.jasper.JasperException; - -/** - * Class responsible for determining the scripting variables that every - * custom action needs to declare. - * - * @author Jan Luehe - */ -class ScriptingVariabler { - - private static final Integer MAX_SCOPE = new Integer(Integer.MAX_VALUE); - - /* - * Assigns an identifier (of type integer) to every custom tag, in order - * to help identify, for every custom tag, the scripting variables that it - * needs to declare. - */ - static class CustomTagCounter extends Node.Visitor { - - private int count; - private Node.CustomTag parent; - - public void visit(Node.CustomTag n) throws JasperException { - n.setCustomTagParent(parent); - Node.CustomTag tmpParent = parent; - parent = n; - visitBody(n); - parent = tmpParent; - n.setNumCount(new Integer(count++)); - } - } - - /* - * For every custom tag, determines the scripting variables it needs to - * declare. - */ - static class ScriptingVariableVisitor extends Node.Visitor { - - private ErrorDispatcher err; - private Hashtable scriptVars; - - public ScriptingVariableVisitor(ErrorDispatcher err) { - this.err = err; - scriptVars = new Hashtable(); - } - - public void visit(Node.CustomTag n) throws JasperException { - setScriptingVars(n, VariableInfo.AT_BEGIN); - setScriptingVars(n, VariableInfo.NESTED); - visitBody(n); - setScriptingVars(n, VariableInfo.AT_END); - } - - private void setScriptingVars(Node.CustomTag n, int scope) - throws JasperException { - - TagVariableInfo[] tagVarInfos = n.getTagVariableInfos(); - VariableInfo[] varInfos = n.getVariableInfos(); - if (tagVarInfos.length == 0 && varInfos.length == 0) { - return; - } - - Vector vec = new Vector(); - - Integer ownRange = null; - if (scope == VariableInfo.AT_BEGIN - || scope == VariableInfo.AT_END) { - Node.CustomTag parent = n.getCustomTagParent(); - if (parent == null) - ownRange = MAX_SCOPE; - else - ownRange = parent.getNumCount(); - } else { - // NESTED - ownRange = n.getNumCount(); - } - - if (varInfos.length > 0) { - for (int i=0; i 0) { - scriptVars.put(varName, ownRange); - vec.add(varInfos[i]); - } - } - } else { - for (int i=0; i 0) { - scriptVars.put(varName, ownRange); - vec.add(tagVarInfos[i]); - } - } - } - - n.setScriptingVars(vec, scope); - } - } - - public static void set(Node.Nodes page, ErrorDispatcher err) - throws JasperException { - page.visit(new CustomTagCounter()); - page.visit(new ScriptingVariableVisitor(err)); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ServletWriter.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ServletWriter.java deleted file mode 100644 index a407f77db..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/ServletWriter.java +++ /dev/null @@ -1,176 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import java.io.IOException; -import java.io.PrintWriter; - -/** - * This is what is used to generate servlets. - * - * @author Anil K. Vijendran - * @author Kin-man Chung - */ -public class ServletWriter { - public static int TAB_WIDTH = 2; - public static String SPACES = " "; - - // Current indent level: - private int indent = 0; - private int virtual_indent = 0; - - // The sink writer: - PrintWriter writer; - - // servlet line numbers start from 1 - private int javaLine = 1; - - - public ServletWriter(PrintWriter writer) { - this.writer = writer; - } - - public void close() throws IOException { - writer.close(); - } - - - // -------------------- Access informations -------------------- - - public int getJavaLine() { - return javaLine; - } - - - // -------------------- Formatting -------------------- - - public void pushIndent() { - virtual_indent += TAB_WIDTH; - if (virtual_indent >= 0 && virtual_indent <= SPACES.length()) - indent = virtual_indent; - } - - public void popIndent() { - virtual_indent -= TAB_WIDTH; - if (virtual_indent >= 0 && virtual_indent <= SPACES.length()) - indent = virtual_indent; - } - - /** - * Print a standard comment for echo outputed chunk. - * @param start The starting position of the JSP chunk being processed. - * @param stop The ending position of the JSP chunk being processed. - */ - public void printComment(Mark start, Mark stop, char[] chars) { - if (start != null && stop != null) { - println("// from="+start); - println("// to="+stop); - } - - if (chars != null) - for(int i = 0; i < chars.length;) { - printin(); - print("// "); - while (chars[i] != '\n' && i < chars.length) - writer.print(chars[i++]); - } - } - - /** - * Prints the given string followed by '\n' - */ - public void println(String s) { - javaLine++; - writer.println(s); - } - - /** - * Prints a '\n' - */ - public void println() { - javaLine++; - writer.println(""); - } - - /** - * Prints the current indention - */ - public void printin() { - writer.print(SPACES.substring(0, indent)); - } - - /** - * Prints the current indention, followed by the given string - */ - public void printin(String s) { - writer.print(SPACES.substring(0, indent)); - writer.print(s); - } - - /** - * Prints the current indention, and then the string, and a '\n'. - */ - public void printil(String s) { - javaLine++; - writer.print(SPACES.substring(0, indent)); - writer.println(s); - } - - /** - * Prints the given char. - * - * Use println() to print a '\n'. - */ - public void print(char c) { - writer.print(c); - } - - /** - * Prints the given int. - */ - public void print(int i) { - writer.print(i); - } - - /** - * Prints the given string. - * - * The string must not contain any '\n', otherwise the line count will be - * off. - */ - public void print(String s) { - writer.print(s); - } - - /** - * Prints the given string. - * - * If the string spans multiple lines, the line count will be adjusted - * accordingly. - */ - public void printMultiLn(String s) { - int index = 0; - - // look for hidden newlines inside strings - while ((index=s.indexOf('\n',index)) > -1 ) { - javaLine++; - index++; - } - - writer.print(s); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapGenerator.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapGenerator.java deleted file mode 100644 index 67374478c..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapGenerator.java +++ /dev/null @@ -1,171 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.util.List; -import java.util.ArrayList; - -/** - * Represents a source map (SMAP), which serves to associate lines - * of the input JSP file(s) to lines in the generated servlet in the - * final .class file, according to the JSR-045 spec. - * - * @author Shawn Bayern - */ -public class SmapGenerator { - - //********************************************************************* - // Overview - - /* - * The SMAP syntax is reasonably straightforward. The purpose of this - * class is currently twofold: - * - to provide a simple but low-level Java interface to build - * a logical SMAP - * - to serialize this logical SMAP for eventual inclusion directly - * into a .class file. - */ - - - //********************************************************************* - // Private state - - private String outputFileName; - private String defaultStratum = "Java"; - private List strata = new ArrayList(); - private List embedded = new ArrayList(); - private boolean doEmbedded = true; - - //********************************************************************* - // Methods for adding mapping data - - /** - * Sets the filename (without path information) for the generated - * source file. E.g., "foo$jsp.java". - */ - public synchronized void setOutputFileName(String x) { - outputFileName = x; - } - - /** - * Adds the given SmapStratum object, representing a Stratum with - * logically associated FileSection and LineSection blocks, to - * the current SmapGenerator. If default is true, this - * stratum is made the default stratum, overriding any previously - * set default. - * - * @param stratum the SmapStratum object to add - * @param defaultStratum if true, this SmapStratum is considered - * to represent the default SMAP stratum unless - * overwritten - */ - public synchronized void addStratum(SmapStratum stratum, - boolean defaultStratum) { - strata.add(stratum); - if (defaultStratum) - this.defaultStratum = stratum.getStratumName(); - } - - /** - * Adds the given string as an embedded SMAP with the given stratum name. - * - * @param smap the SMAP to embed - * @param stratumName the name of the stratum output by the compilation - * that produced the smap to be embedded - */ - public synchronized void addSmap(String smap, String stratumName) { - embedded.add("*O " + stratumName + "\n" - + smap - + "*C " + stratumName + "\n"); - } - - /** - * Instructs the SmapGenerator whether to actually print any embedded - * SMAPs or not. Intended for situations without an SMAP resolver. - * - * @param status If false, ignore any embedded SMAPs. - */ - public void setDoEmbedded(boolean status) { - doEmbedded = status; - } - - //********************************************************************* - // Methods for serializing the logical SMAP - - public synchronized String getString() { - // check state and initialize buffer - if (outputFileName == null) - throw new IllegalStateException(); - StringBuffer out = new StringBuffer(); - - // start the SMAP - out.append("SMAP\n"); - out.append(outputFileName + '\n'); - out.append(defaultStratum + '\n'); - - // include embedded SMAPs - if (doEmbedded) { - int nEmbedded = embedded.size(); - for (int i = 0; i < nEmbedded; i++) { - out.append(embedded.get(i)); - } - } - - // print our StratumSections, FileSections, and LineSections - int nStrata = strata.size(); - for (int i = 0; i < nStrata; i++) { - SmapStratum s = (SmapStratum) strata.get(i); - out.append(s.getString()); - } - - // end the SMAP - out.append("*E\n"); - - return out.toString(); - } - - public String toString() { return getString(); } - - //********************************************************************* - // For testing (and as an example of use)... - - public static void main(String args[]) { - SmapGenerator g = new SmapGenerator(); - g.setOutputFileName("foo.java"); - SmapStratum s = new SmapStratum("JSP"); - s.addFile("foo.jsp"); - s.addFile("bar.jsp", "/foo/foo/bar.jsp"); - s.addLineData(1, "foo.jsp", 1, 1, 1); - s.addLineData(2, "foo.jsp", 1, 6, 1); - s.addLineData(3, "foo.jsp", 2, 10, 5); - s.addLineData(20, "bar.jsp", 1, 30, 1); - g.addStratum(s, true); - System.out.print(g); - - System.out.println("---"); - - SmapGenerator embedded = new SmapGenerator(); - embedded.setOutputFileName("blargh.tier2"); - s = new SmapStratum("Tier2"); - s.addFile("1.tier2"); - s.addLineData(1, "1.tier2", 1, 1, 1); - embedded.addStratum(s, true); - g.addSmap(embedded.toString(), "JSP"); - System.out.println(g); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapStratum.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapStratum.java deleted file mode 100644 index d0c506e1a..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapStratum.java +++ /dev/null @@ -1,336 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.util.List; -import java.util.ArrayList; - -/** - * Represents the line and file mappings associated with a JSR-045 - * "stratum". - * - * @author Jayson Falkner - * @author Shawn Bayern - */ -public class SmapStratum { - - //********************************************************************* - // Class for storing LineInfo data - - /** - * Represents a single LineSection in an SMAP, associated with - * a particular stratum. - */ - public static class LineInfo { - private int inputStartLine = -1; - private int outputStartLine = -1; - private int lineFileID = 0; - private int inputLineCount = 1; - private int outputLineIncrement = 1; - private boolean lineFileIDSet = false; - - /** Sets InputStartLine. */ - public void setInputStartLine(int inputStartLine) { - if (inputStartLine < 0) - throw new IllegalArgumentException("" + inputStartLine); - this.inputStartLine = inputStartLine; - } - - /** Sets OutputStartLine. */ - public void setOutputStartLine(int outputStartLine) { - if (outputStartLine < 0) - throw new IllegalArgumentException("" + outputStartLine); - this.outputStartLine = outputStartLine; - } - - /** - * Sets lineFileID. Should be called only when different from - * that of prior LineInfo object (in any given context) or 0 - * if the current LineInfo has no (logical) predecessor. - * LineInfo will print this file number no matter what. - */ - public void setLineFileID(int lineFileID) { - if (lineFileID < 0) - throw new IllegalArgumentException("" + lineFileID); - this.lineFileID = lineFileID; - this.lineFileIDSet = true; - } - - /** Sets InputLineCount. */ - public void setInputLineCount(int inputLineCount) { - if (inputLineCount < 0) - throw new IllegalArgumentException("" + inputLineCount); - this.inputLineCount = inputLineCount; - } - - /** Sets OutputLineIncrement. */ - public void setOutputLineIncrement(int outputLineIncrement) { - if (outputLineIncrement < 0) - throw new IllegalArgumentException("" + outputLineIncrement); - this.outputLineIncrement = outputLineIncrement; - } - - /** - * Retrieves the current LineInfo as a String, print all values - * only when appropriate (but LineInfoID if and only if it's been - * specified, as its necessity is sensitive to context). - */ - public String getString() { - if (inputStartLine == -1 || outputStartLine == -1) - throw new IllegalStateException(); - StringBuffer out = new StringBuffer(); - out.append(inputStartLine); - if (lineFileIDSet) - out.append("#" + lineFileID); - if (inputLineCount != 1) - out.append("," + inputLineCount); - out.append(":" + outputStartLine); - if (outputLineIncrement != 1) - out.append("," + outputLineIncrement); - out.append('\n'); - return out.toString(); - } - - public String toString() { - return getString(); - } - } - - //********************************************************************* - // Private state - - private String stratumName; - private List fileNameList; - private List filePathList; - private List lineData; - private int lastFileID; - - //********************************************************************* - // Constructor - - /** - * Constructs a new SmapStratum object for the given stratum name - * (e.g., JSP). - * - * @param stratumName the name of the stratum (e.g., JSP) - */ - public SmapStratum(String stratumName) { - this.stratumName = stratumName; - fileNameList = new ArrayList(); - filePathList = new ArrayList(); - lineData = new ArrayList(); - lastFileID = 0; - } - - //********************************************************************* - // Methods to add mapping information - - /** - * Adds record of a new file, by filename. - * - * @param filename the filename to add, unqualified by path. - */ - public void addFile(String filename) { - addFile(filename, filename); - } - - /** - * Adds record of a new file, by filename and path. The path - * may be relative to a source compilation path. - * - * @param filename the filename to add, unqualified by path - * @param filePath the path for the filename, potentially relative - * to a source compilation path - */ - public void addFile(String filename, String filePath) { - int pathIndex = filePathList.indexOf(filePath); - if (pathIndex == -1) { - fileNameList.add(filename); - filePathList.add(filePath); - } - } - - /** - * Combines consecutive LineInfos wherever possible - */ - public void optimizeLineSection() { - -/* Some debugging code - for (int i = 0; i < lineData.size(); i++) { - LineInfo li = (LineInfo)lineData.get(i); - System.out.print(li.toString()); - } -*/ - //Incorporate each LineInfo into the previous LineInfo's - //outputLineIncrement, if possible - int i = 0; - while (i < lineData.size() - 1) { - LineInfo li = (LineInfo)lineData.get(i); - LineInfo liNext = (LineInfo)lineData.get(i + 1); - if (!liNext.lineFileIDSet - && liNext.inputStartLine == li.inputStartLine - && liNext.inputLineCount == 1 - && li.inputLineCount == 1 - && liNext.outputStartLine - == li.outputStartLine - + li.inputLineCount * li.outputLineIncrement) { - li.setOutputLineIncrement( - liNext.outputStartLine - - li.outputStartLine - + liNext.outputLineIncrement); - lineData.remove(i + 1); - } else { - i++; - } - } - - //Incorporate each LineInfo into the previous LineInfo's - //inputLineCount, if possible - i = 0; - while (i < lineData.size() - 1) { - LineInfo li = (LineInfo)lineData.get(i); - LineInfo liNext = (LineInfo)lineData.get(i + 1); - if (!liNext.lineFileIDSet - && liNext.inputStartLine == li.inputStartLine + li.inputLineCount - && liNext.outputLineIncrement == li.outputLineIncrement - && liNext.outputStartLine - == li.outputStartLine - + li.inputLineCount * li.outputLineIncrement) { - li.setInputLineCount(li.inputLineCount + liNext.inputLineCount); - lineData.remove(i + 1); - } else { - i++; - } - } - } - - /** - * Adds complete information about a simple line mapping. Specify - * all the fields in this method; the back-end machinery takes care - * of printing only those that are necessary in the final SMAP. - * (My view is that fields are optional primarily for spatial efficiency, - * not for programmer convenience. Could always add utility methods - * later.) - * - * @param inputStartLine starting line in the source file - * (SMAP InputStartLine) - * @param inputFileName the filepath (or name) from which the input comes - * (yields SMAP LineFileID) Use unqualified names - * carefully, and only when they uniquely identify a file. - * @param inputLineCount the number of lines in the input to map - * (SMAP LineFileCount) - * @param outputStartLine starting line in the output file - * (SMAP OutputStartLine) - * @param outputLineIncrement number of output lines to map to each - * input line (SMAP OutputLineIncrement). Given the - * fact that the name starts with "output", I continuously have - * the subconscious urge to call this field - * OutputLineExcrement. - */ - public void addLineData( - int inputStartLine, - String inputFileName, - int inputLineCount, - int outputStartLine, - int outputLineIncrement) { - // check the input - what are you doing here?? - int fileIndex = filePathList.indexOf(inputFileName); - if (fileIndex == -1) // still - throw new IllegalArgumentException( - "inputFileName: " + inputFileName); - - //Jasper incorrectly SMAPs certain Nodes, giving them an - //outputStartLine of 0. This can cause a fatal error in - //optimizeLineSection, making it impossible for Jasper to - //compile the JSP. Until we can fix the underlying - //SMAPping problem, we simply ignore the flawed SMAP entries. - if (outputStartLine == 0) - return; - - // build the LineInfo - LineInfo li = new LineInfo(); - li.setInputStartLine(inputStartLine); - li.setInputLineCount(inputLineCount); - li.setOutputStartLine(outputStartLine); - li.setOutputLineIncrement(outputLineIncrement); - if (fileIndex != lastFileID) - li.setLineFileID(fileIndex); - lastFileID = fileIndex; - - // save it - lineData.add(li); - } - - //********************************************************************* - // Methods to retrieve information - - /** - * Returns the name of the stratum. - */ - public String getStratumName() { - return stratumName; - } - - /** - * Returns the given stratum as a String: a StratumSection, - * followed by at least one FileSection and at least one LineSection. - */ - public String getString() { - // check state and initialize buffer - if (fileNameList.size() == 0 || lineData.size() == 0) - return null; - - StringBuffer out = new StringBuffer(); - - // print StratumSection - out.append("*S " + stratumName + "\n"); - - // print FileSection - out.append("*F\n"); - int bound = fileNameList.size(); - for (int i = 0; i < bound; i++) { - if (filePathList.get(i) != null) { - out.append("+ " + i + " " + fileNameList.get(i) + "\n"); - // Source paths must be relative, not absolute, so we - // remove the leading "/", if one exists. - String filePath = (String)filePathList.get(i); - if (filePath.startsWith("/")) { - filePath = filePath.substring(1); - } - out.append(filePath + "\n"); - } else { - out.append(i + " " + fileNameList.get(i) + "\n"); - } - } - - // print LineSection - out.append("*L\n"); - bound = lineData.size(); - for (int i = 0; i < bound; i++) { - LineInfo li = (LineInfo)lineData.get(i); - out.append(li.getString()); - } - - return out.toString(); - } - - public String toString() { - return getString(); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapUtil.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapUtil.java deleted file mode 100644 index c9e08ec08..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/SmapUtil.java +++ /dev/null @@ -1,729 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.File; -import java.io.FileInputStream; -import java.io.FileNotFoundException; -import java.io.FileOutputStream; -import java.io.IOException; -import java.io.OutputStreamWriter; -import java.io.PrintWriter; -import java.io.UnsupportedEncodingException; -import java.util.HashMap; -import java.util.Iterator; -import java.util.Map; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; - -/** - * Contains static utilities for generating SMAP data based on the - * current version of Jasper. - * - * @author Jayson Falkner - * @author Shawn Bayern - * @author Robert Field (inner SDEInstaller class) - * @author Mark Roth - * @author Kin-man Chung - */ -public class SmapUtil { - - private org.apache.juli.logging.Log log= - org.apache.juli.logging.LogFactory.getLog( SmapUtil.class ); - - //********************************************************************* - // Constants - - public static final String SMAP_ENCODING = "UTF-8"; - - //********************************************************************* - // Public entry points - - /** - * Generates an appropriate SMAP representing the current compilation - * context. (JSR-045.) - * - * @param ctxt Current compilation context - * @param pageNodes The current JSP page - * @return a SMAP for the page - */ - public static String[] generateSmap( - JspCompilationContext ctxt, - Node.Nodes pageNodes) - throws IOException { - - // Scan the nodes for presence of Jasper generated inner classes - PreScanVisitor psVisitor = new PreScanVisitor(); - try { - pageNodes.visit(psVisitor); - } catch (JasperException ex) { - } - HashMap map = psVisitor.getMap(); - - // set up our SMAP generator - SmapGenerator g = new SmapGenerator(); - - /** Disable reading of input SMAP because: - 1. There is a bug here: getRealPath() is null if .jsp is in a jar - Bugzilla 14660. - 2. Mappings from other sources into .jsp files are not supported. - TODO: fix 1. if 2. is not true. - // determine if we have an input SMAP - String smapPath = inputSmapPath(ctxt.getRealPath(ctxt.getJspFile())); - File inputSmap = new File(smapPath); - if (inputSmap.exists()) { - byte[] embeddedSmap = null; - byte[] subSmap = SDEInstaller.readWhole(inputSmap); - String subSmapString = new String(subSmap, SMAP_ENCODING); - g.addSmap(subSmapString, "JSP"); - } - **/ - - // now, assemble info about our own stratum (JSP) using JspLineMap - SmapStratum s = new SmapStratum("JSP"); - - g.setOutputFileName(unqualify(ctxt.getServletJavaFileName())); - - // Map out Node.Nodes - evaluateNodes(pageNodes, s, map, ctxt.getOptions().getMappedFile()); - s.optimizeLineSection(); - g.addStratum(s, true); - - if (ctxt.getOptions().isSmapDumped()) { - File outSmap = new File(ctxt.getClassFileName() + ".smap"); - PrintWriter so = - new PrintWriter( - new OutputStreamWriter( - new FileOutputStream(outSmap), - SMAP_ENCODING)); - so.print(g.getString()); - so.close(); - } - - String classFileName = ctxt.getClassFileName(); - int innerClassCount = map.size(); - String [] smapInfo = new String[2 + innerClassCount*2]; - smapInfo[0] = classFileName; - smapInfo[1] = g.getString(); - - int count = 2; - Iterator iter = map.entrySet().iterator(); - while (iter.hasNext()) { - Map.Entry entry = (Map.Entry) iter.next(); - String innerClass = (String) entry.getKey(); - s = (SmapStratum) entry.getValue(); - s.optimizeLineSection(); - g = new SmapGenerator(); - g.setOutputFileName(unqualify(ctxt.getServletJavaFileName())); - g.addStratum(s, true); - - String innerClassFileName = - classFileName.substring(0, classFileName.indexOf(".class")) + - '$' + innerClass + ".class"; - if (ctxt.getOptions().isSmapDumped()) { - File outSmap = new File(innerClassFileName + ".smap"); - PrintWriter so = - new PrintWriter( - new OutputStreamWriter( - new FileOutputStream(outSmap), - SMAP_ENCODING)); - so.print(g.getString()); - so.close(); - } - smapInfo[count] = innerClassFileName; - smapInfo[count+1] = g.getString(); - count += 2; - } - - return smapInfo; - } - - public static void installSmap(String[] smap) - throws IOException { - if (smap == null) { - return; - } - - for (int i = 0; i < smap.length; i += 2) { - File outServlet = new File(smap[i]); - SDEInstaller.install(outServlet, smap[i+1].getBytes()); - } - } - - //********************************************************************* - // Private utilities - - /** - * Returns an unqualified version of the given file path. - */ - private static String unqualify(String path) { - path = path.replace('\\', '/'); - return path.substring(path.lastIndexOf('/') + 1); - } - - /** - * Returns a file path corresponding to a potential SMAP input - * for the given compilation input (JSP file). - */ - private static String inputSmapPath(String path) { - return path.substring(0, path.lastIndexOf('.') + 1) + "smap"; - } - - //********************************************************************* - // Installation logic (from Robert Field, JSR-045 spec lead) - private static class SDEInstaller { - - private org.apache.juli.logging.Log log= - org.apache.juli.logging.LogFactory.getLog( SDEInstaller.class ); - - static final String nameSDE = "SourceDebugExtension"; - - byte[] orig; - byte[] sdeAttr; - byte[] gen; - - int origPos = 0; - int genPos = 0; - - int sdeIndex; - - public static void main(String[] args) throws IOException { - if (args.length == 2) { - install(new File(args[0]), new File(args[1])); - } else if (args.length == 3) { - install( - new File(args[0]), - new File(args[1]), - new File(args[2])); - } else { - System.err.println( - "Usage: " - + " \n" - + " "); - } - } - - static void install(File inClassFile, File attrFile, File outClassFile) - throws IOException { - new SDEInstaller(inClassFile, attrFile, outClassFile); - } - - static void install(File inOutClassFile, File attrFile) - throws IOException { - File tmpFile = new File(inOutClassFile.getPath() + "tmp"); - new SDEInstaller(inOutClassFile, attrFile, tmpFile); - if (!inOutClassFile.delete()) { - throw new IOException("inOutClassFile.delete() failed"); - } - if (!tmpFile.renameTo(inOutClassFile)) { - throw new IOException("tmpFile.renameTo(inOutClassFile) failed"); - } - } - - static void install(File classFile, byte[] smap) throws IOException { - File tmpFile = new File(classFile.getPath() + "tmp"); - new SDEInstaller(classFile, smap, tmpFile); - if (!classFile.delete()) { - throw new IOException("classFile.delete() failed"); - } - if (!tmpFile.renameTo(classFile)) { - throw new IOException("tmpFile.renameTo(classFile) failed"); - } - } - - SDEInstaller(File inClassFile, byte[] sdeAttr, File outClassFile) - throws IOException { - if (!inClassFile.exists()) { - throw new FileNotFoundException("no such file: " + inClassFile); - } - - this.sdeAttr = sdeAttr; - // get the bytes - orig = readWhole(inClassFile); - gen = new byte[orig.length + sdeAttr.length + 100]; - - // do it - addSDE(); - - // write result - FileOutputStream outStream = new FileOutputStream(outClassFile); - outStream.write(gen, 0, genPos); - outStream.close(); - } - - SDEInstaller(File inClassFile, File attrFile, File outClassFile) - throws IOException { - this(inClassFile, readWhole(attrFile), outClassFile); - } - - static byte[] readWhole(File input) throws IOException { - FileInputStream inStream = new FileInputStream(input); - int len = (int)input.length(); - byte[] bytes = new byte[len]; - if (inStream.read(bytes, 0, len) != len) { - throw new IOException("expected size: " + len); - } - inStream.close(); - return bytes; - } - - void addSDE() throws UnsupportedEncodingException, IOException { - int i; - copy(4 + 2 + 2); // magic min/maj version - int constantPoolCountPos = genPos; - int constantPoolCount = readU2(); - if (log.isDebugEnabled()) - log.debug("constant pool count: " + constantPoolCount); - writeU2(constantPoolCount); - - // copy old constant pool return index of SDE symbol, if found - sdeIndex = copyConstantPool(constantPoolCount); - if (sdeIndex < 0) { - // if "SourceDebugExtension" symbol not there add it - writeUtf8ForSDE(); - - // increment the countantPoolCount - sdeIndex = constantPoolCount; - ++constantPoolCount; - randomAccessWriteU2(constantPoolCountPos, constantPoolCount); - - if (log.isDebugEnabled()) - log.debug("SourceDebugExtension not found, installed at: " + sdeIndex); - } else { - if (log.isDebugEnabled()) - log.debug("SourceDebugExtension found at: " + sdeIndex); - } - copy(2 + 2 + 2); // access, this, super - int interfaceCount = readU2(); - writeU2(interfaceCount); - if (log.isDebugEnabled()) - log.debug("interfaceCount: " + interfaceCount); - copy(interfaceCount * 2); - copyMembers(); // fields - copyMembers(); // methods - int attrCountPos = genPos; - int attrCount = readU2(); - writeU2(attrCount); - if (log.isDebugEnabled()) - log.debug("class attrCount: " + attrCount); - // copy the class attributes, return true if SDE attr found (not copied) - if (!copyAttrs(attrCount)) { - // we will be adding SDE and it isn't already counted - ++attrCount; - randomAccessWriteU2(attrCountPos, attrCount); - if (log.isDebugEnabled()) - log.debug("class attrCount incremented"); - } - writeAttrForSDE(sdeIndex); - } - - void copyMembers() { - int count = readU2(); - writeU2(count); - if (log.isDebugEnabled()) - log.debug("members count: " + count); - for (int i = 0; i < count; ++i) { - copy(6); // access, name, descriptor - int attrCount = readU2(); - writeU2(attrCount); - if (log.isDebugEnabled()) - log.debug("member attr count: " + attrCount); - copyAttrs(attrCount); - } - } - - boolean copyAttrs(int attrCount) { - boolean sdeFound = false; - for (int i = 0; i < attrCount; ++i) { - int nameIndex = readU2(); - // don't write old SDE - if (nameIndex == sdeIndex) { - sdeFound = true; - if (log.isDebugEnabled()) - log.debug("SDE attr found"); - } else { - writeU2(nameIndex); // name - int len = readU4(); - writeU4(len); - copy(len); - if (log.isDebugEnabled()) - log.debug("attr len: " + len); - } - } - return sdeFound; - } - - void writeAttrForSDE(int index) { - writeU2(index); - writeU4(sdeAttr.length); - for (int i = 0; i < sdeAttr.length; ++i) { - writeU1(sdeAttr[i]); - } - } - - void randomAccessWriteU2(int pos, int val) { - int savePos = genPos; - genPos = pos; - writeU2(val); - genPos = savePos; - } - - int readU1() { - return ((int)orig[origPos++]) & 0xFF; - } - - int readU2() { - int res = readU1(); - return (res << 8) + readU1(); - } - - int readU4() { - int res = readU2(); - return (res << 16) + readU2(); - } - - void writeU1(int val) { - gen[genPos++] = (byte)val; - } - - void writeU2(int val) { - writeU1(val >> 8); - writeU1(val & 0xFF); - } - - void writeU4(int val) { - writeU2(val >> 16); - writeU2(val & 0xFFFF); - } - - void copy(int count) { - for (int i = 0; i < count; ++i) { - gen[genPos++] = orig[origPos++]; - } - } - - byte[] readBytes(int count) { - byte[] bytes = new byte[count]; - for (int i = 0; i < count; ++i) { - bytes[i] = orig[origPos++]; - } - return bytes; - } - - void writeBytes(byte[] bytes) { - for (int i = 0; i < bytes.length; ++i) { - gen[genPos++] = bytes[i]; - } - } - - int copyConstantPool(int constantPoolCount) - throws UnsupportedEncodingException, IOException { - int sdeIndex = -1; - // copy const pool index zero not in class file - for (int i = 1; i < constantPoolCount; ++i) { - int tag = readU1(); - writeU1(tag); - switch (tag) { - case 7 : // Class - case 8 : // String - if (log.isDebugEnabled()) - log.debug(i + " copying 2 bytes"); - copy(2); - break; - case 9 : // Field - case 10 : // Method - case 11 : // InterfaceMethod - case 3 : // Integer - case 4 : // Float - case 12 : // NameAndType - if (log.isDebugEnabled()) - log.debug(i + " copying 4 bytes"); - copy(4); - break; - case 5 : // Long - case 6 : // Double - if (log.isDebugEnabled()) - log.debug(i + " copying 8 bytes"); - copy(8); - i++; - break; - case 1 : // Utf8 - int len = readU2(); - writeU2(len); - byte[] utf8 = readBytes(len); - String str = new String(utf8, "UTF-8"); - if (log.isDebugEnabled()) - log.debug(i + " read class attr -- '" + str + "'"); - if (str.equals(nameSDE)) { - sdeIndex = i; - } - writeBytes(utf8); - break; - default : - throw new IOException("unexpected tag: " + tag); - } - } - return sdeIndex; - } - - void writeUtf8ForSDE() { - int len = nameSDE.length(); - writeU1(1); // Utf8 tag - writeU2(len); - for (int i = 0; i < len; ++i) { - writeU1(nameSDE.charAt(i)); - } - } - } - - public static void evaluateNodes( - Node.Nodes nodes, - SmapStratum s, - HashMap innerClassMap, - boolean breakAtLF) { - try { - nodes.visit(new SmapGenVisitor(s, breakAtLF, innerClassMap)); - } catch (JasperException ex) { - } - } - - static class SmapGenVisitor extends Node.Visitor { - - private SmapStratum smap; - private boolean breakAtLF; - private HashMap innerClassMap; - - SmapGenVisitor(SmapStratum s, boolean breakAtLF, HashMap map) { - this.smap = s; - this.breakAtLF = breakAtLF; - this.innerClassMap = map; - } - - public void visitBody(Node n) throws JasperException { - SmapStratum smapSave = smap; - String innerClass = n.getInnerClassName(); - if (innerClass != null) { - this.smap = (SmapStratum) innerClassMap.get(innerClass); - } - super.visitBody(n); - smap = smapSave; - } - - public void visit(Node.Declaration n) throws JasperException { - doSmapText(n); - } - - public void visit(Node.Expression n) throws JasperException { - doSmapText(n); - } - - public void visit(Node.Scriptlet n) throws JasperException { - doSmapText(n); - } - - public void visit(Node.IncludeAction n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.ForwardAction n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.GetProperty n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.SetProperty n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.UseBean n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.PlugIn n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.CustomTag n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.UninterpretedTag n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.JspElement n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.JspText n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.NamedAttribute n) throws JasperException { - visitBody(n); - } - - public void visit(Node.JspBody n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.InvokeAction n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.DoBodyAction n) throws JasperException { - doSmap(n); - visitBody(n); - } - - public void visit(Node.ELExpression n) throws JasperException { - doSmap(n); - } - - public void visit(Node.TemplateText n) throws JasperException { - Mark mark = n.getStart(); - if (mark == null) { - return; - } - - //Add the file information - String fileName = mark.getFile(); - smap.addFile(unqualify(fileName), fileName); - - //Add a LineInfo that corresponds to the beginning of this node - int iInputStartLine = mark.getLineNumber(); - int iOutputStartLine = n.getBeginJavaLine(); - int iOutputLineIncrement = breakAtLF? 1: 0; - smap.addLineData(iInputStartLine, fileName, 1, iOutputStartLine, - iOutputLineIncrement); - - // Output additional mappings in the text - java.util.ArrayList extraSmap = n.getExtraSmap(); - - if (extraSmap != null) { - for (int i = 0; i < extraSmap.size(); i++) { - iOutputStartLine += iOutputLineIncrement; - smap.addLineData( - iInputStartLine+((Integer)extraSmap.get(i)).intValue(), - fileName, - 1, - iOutputStartLine, - iOutputLineIncrement); - } - } - } - - private void doSmap( - Node n, - int inLineCount, - int outIncrement, - int skippedLines) { - Mark mark = n.getStart(); - if (mark == null) { - return; - } - - String unqualifiedName = unqualify(mark.getFile()); - smap.addFile(unqualifiedName, mark.getFile()); - smap.addLineData( - mark.getLineNumber() + skippedLines, - mark.getFile(), - inLineCount - skippedLines, - n.getBeginJavaLine() + skippedLines, - outIncrement); - } - - private void doSmap(Node n) { - doSmap(n, 1, n.getEndJavaLine() - n.getBeginJavaLine(), 0); - } - - private void doSmapText(Node n) { - String text = n.getText(); - int index = 0; - int next = 0; - int lineCount = 1; - int skippedLines = 0; - boolean slashStarSeen = false; - boolean beginning = true; - - // Count lines inside text, but skipping comment lines at the - // beginning of the text. - while ((next = text.indexOf('\n', index)) > -1) { - if (beginning) { - String line = text.substring(index, next).trim(); - if (!slashStarSeen && line.startsWith("/*")) { - slashStarSeen = true; - } - if (slashStarSeen) { - skippedLines++; - int endIndex = line.indexOf("*/"); - if (endIndex >= 0) { - // End of /* */ comment - slashStarSeen = false; - if (endIndex < line.length() - 2) { - // Some executable code after comment - skippedLines--; - beginning = false; - } - } - } else if (line.length() == 0 || line.startsWith("//")) { - skippedLines++; - } else { - beginning = false; - } - } - lineCount++; - index = next + 1; - } - - doSmap(n, lineCount, 1, skippedLines); - } - } - - private static class PreScanVisitor extends Node.Visitor { - - HashMap map = new HashMap(); - - public void doVisit(Node n) { - String inner = n.getInnerClassName(); - if (inner != null && !map.containsKey(inner)) { - map.put(inner, new SmapStratum("JSP")); - } - } - - HashMap getMap() { - return map; - } - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagConstants.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagConstants.java deleted file mode 100644 index 373eb0e9d..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagConstants.java +++ /dev/null @@ -1,116 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -public interface TagConstants { - - public static final String JSP_URI = "http://java.sun.com/JSP/Page"; - - public static final String DIRECTIVE_ACTION = "directive."; - - public static final String ROOT_ACTION = "root"; - public static final String JSP_ROOT_ACTION = "jsp:root"; - - public static final String PAGE_DIRECTIVE_ACTION = "directive.page"; - public static final String JSP_PAGE_DIRECTIVE_ACTION = "jsp:directive.page"; - - public static final String INCLUDE_DIRECTIVE_ACTION = "directive.include"; - public static final String JSP_INCLUDE_DIRECTIVE_ACTION = "jsp:directive.include"; - - public static final String DECLARATION_ACTION = "declaration"; - public static final String JSP_DECLARATION_ACTION = "jsp:declaration"; - - public static final String SCRIPTLET_ACTION = "scriptlet"; - public static final String JSP_SCRIPTLET_ACTION = "jsp:scriptlet"; - - public static final String EXPRESSION_ACTION = "expression"; - public static final String JSP_EXPRESSION_ACTION = "jsp:expression"; - - public static final String USE_BEAN_ACTION = "useBean"; - public static final String JSP_USE_BEAN_ACTION = "jsp:useBean"; - - public static final String SET_PROPERTY_ACTION = "setProperty"; - public static final String JSP_SET_PROPERTY_ACTION = "jsp:setProperty"; - - public static final String GET_PROPERTY_ACTION = "getProperty"; - public static final String JSP_GET_PROPERTY_ACTION = "jsp:getProperty"; - - public static final String INCLUDE_ACTION = "include"; - public static final String JSP_INCLUDE_ACTION = "jsp:include"; - - public static final String FORWARD_ACTION = "forward"; - public static final String JSP_FORWARD_ACTION = "jsp:forward"; - - public static final String PARAM_ACTION = "param"; - public static final String JSP_PARAM_ACTION = "jsp:param"; - - public static final String PARAMS_ACTION = "params"; - public static final String JSP_PARAMS_ACTION = "jsp:params"; - - public static final String PLUGIN_ACTION = "plugin"; - public static final String JSP_PLUGIN_ACTION = "jsp:plugin"; - - public static final String FALLBACK_ACTION = "fallback"; - public static final String JSP_FALLBACK_ACTION = "jsp:fallback"; - - public static final String TEXT_ACTION = "text"; - public static final String JSP_TEXT_ACTION = "jsp:text"; - public static final String JSP_TEXT_ACTION_END = ""; - - public static final String ATTRIBUTE_ACTION = "attribute"; - public static final String JSP_ATTRIBUTE_ACTION = "jsp:attribute"; - - public static final String BODY_ACTION = "body"; - public static final String JSP_BODY_ACTION = "jsp:body"; - - public static final String ELEMENT_ACTION = "element"; - public static final String JSP_ELEMENT_ACTION = "jsp:element"; - - public static final String OUTPUT_ACTION = "output"; - public static final String JSP_OUTPUT_ACTION = "jsp:output"; - - public static final String TAGLIB_DIRECTIVE_ACTION = "taglib"; - public static final String JSP_TAGLIB_DIRECTIVE_ACTION = "jsp:taglib"; - - /* - * Tag Files - */ - public static final String INVOKE_ACTION = "invoke"; - public static final String JSP_INVOKE_ACTION = "jsp:invoke"; - - public static final String DOBODY_ACTION = "doBody"; - public static final String JSP_DOBODY_ACTION = "jsp:doBody"; - - /* - * Tag File Directives - */ - public static final String TAG_DIRECTIVE_ACTION = "directive.tag"; - public static final String JSP_TAG_DIRECTIVE_ACTION = "jsp:directive.tag"; - - public static final String ATTRIBUTE_DIRECTIVE_ACTION = "directive.attribute"; - public static final String JSP_ATTRIBUTE_DIRECTIVE_ACTION = "jsp:directive.attribute"; - - public static final String VARIABLE_DIRECTIVE_ACTION = "directive.variable"; - public static final String JSP_VARIABLE_DIRECTIVE_ACTION = "jsp:directive.variable"; - - /* - * Directive attributes - */ - public static final String URN_JSPTAGDIR = "urn:jsptagdir:"; - public static final String URN_JSPTLD = "urn:jsptld:"; -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagFileProcessor.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagFileProcessor.java deleted file mode 100644 index d758bc0af..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagFileProcessor.java +++ /dev/null @@ -1,726 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.FileNotFoundException; -import java.io.IOException; -import java.net.MalformedURLException; -import java.net.URL; -import java.net.URLClassLoader; -import java.util.Iterator; -import java.util.List; -import java.util.Vector; -import java.util.HashMap; - -import javax.el.MethodExpression; -import javax.el.ValueExpression; -import javax.servlet.jsp.tagext.TagAttributeInfo; -import javax.servlet.jsp.tagext.TagExtraInfo; -import javax.servlet.jsp.tagext.TagFileInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagLibraryInfo; -import javax.servlet.jsp.tagext.TagVariableInfo; -import javax.servlet.jsp.tagext.VariableInfo; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.servlet.JspServletWrapper; -import org.apache.jasper.runtime.JspSourceDependent; - -/** - * 1. Processes and extracts the directive info in a tag file. 2. Compiles and - * loads tag files used in a JSP file. - * - * @author Kin-man Chung - */ - -class TagFileProcessor { - - private Vector tempVector; - - /** - * A visitor the tag file - */ - private static class TagFileDirectiveVisitor extends Node.Visitor { - - private static final JspUtil.ValidAttribute[] tagDirectiveAttrs = { - new JspUtil.ValidAttribute("display-name"), - new JspUtil.ValidAttribute("body-content"), - new JspUtil.ValidAttribute("dynamic-attributes"), - new JspUtil.ValidAttribute("small-icon"), - new JspUtil.ValidAttribute("large-icon"), - new JspUtil.ValidAttribute("description"), - new JspUtil.ValidAttribute("example"), - new JspUtil.ValidAttribute("pageEncoding"), - new JspUtil.ValidAttribute("language"), - new JspUtil.ValidAttribute("import"), - new JspUtil.ValidAttribute("deferredSyntaxAllowedAsLiteral"), // JSP 2.1 - new JspUtil.ValidAttribute("trimDirectiveWhitespaces"), // JSP 2.1 - new JspUtil.ValidAttribute("isELIgnored") }; - - private static final JspUtil.ValidAttribute[] attributeDirectiveAttrs = { - new JspUtil.ValidAttribute("name", true), - new JspUtil.ValidAttribute("required"), - new JspUtil.ValidAttribute("fragment"), - new JspUtil.ValidAttribute("rtexprvalue"), - new JspUtil.ValidAttribute("type"), - new JspUtil.ValidAttribute("deferredValue"), // JSP 2.1 - new JspUtil.ValidAttribute("deferredValueType"), // JSP 2.1 - new JspUtil.ValidAttribute("deferredMethod"), // JSP 2 - new JspUtil.ValidAttribute("deferredMethodSignature"), // JSP 21 - new JspUtil.ValidAttribute("description") }; - - private static final JspUtil.ValidAttribute[] variableDirectiveAttrs = { - new JspUtil.ValidAttribute("name-given"), - new JspUtil.ValidAttribute("name-from-attribute"), - new JspUtil.ValidAttribute("alias"), - new JspUtil.ValidAttribute("variable-class"), - new JspUtil.ValidAttribute("scope"), - new JspUtil.ValidAttribute("declare"), - new JspUtil.ValidAttribute("description") }; - - private ErrorDispatcher err; - - private TagLibraryInfo tagLibInfo; - - private String name = null; - - private String path = null; - - private TagExtraInfo tei = null; - - private String bodycontent = null; - - private String description = null; - - private String displayName = null; - - private String smallIcon = null; - - private String largeIcon = null; - - private String dynamicAttrsMapName; - - private String example = null; - - private Vector attributeVector; - - private Vector variableVector; - - private static final String ATTR_NAME = "the name attribute of the attribute directive"; - - private static final String VAR_NAME_GIVEN = "the name-given attribute of the variable directive"; - - private static final String VAR_NAME_FROM = "the name-from-attribute attribute of the variable directive"; - - private static final String VAR_ALIAS = "the alias attribute of the variable directive"; - - private static final String TAG_DYNAMIC = "the dynamic-attributes attribute of the tag directive"; - - private HashMap nameTable = new HashMap(); - - private HashMap nameFromTable = new HashMap(); - - public TagFileDirectiveVisitor(Compiler compiler, - TagLibraryInfo tagLibInfo, String name, String path) { - err = compiler.getErrorDispatcher(); - this.tagLibInfo = tagLibInfo; - this.name = name; - this.path = path; - attributeVector = new Vector(); - variableVector = new Vector(); - } - - public void visit(Node.TagDirective n) throws JasperException { - - JspUtil.checkAttributes("Tag directive", n, tagDirectiveAttrs, err); - - bodycontent = checkConflict(n, bodycontent, "body-content"); - if (bodycontent != null - && !bodycontent - .equalsIgnoreCase(TagInfo.BODY_CONTENT_EMPTY) - && !bodycontent - .equalsIgnoreCase(TagInfo.BODY_CONTENT_TAG_DEPENDENT) - && !bodycontent - .equalsIgnoreCase(TagInfo.BODY_CONTENT_SCRIPTLESS)) { - err.jspError(n, "jsp.error.tagdirective.badbodycontent", - bodycontent); - } - dynamicAttrsMapName = checkConflict(n, dynamicAttrsMapName, - "dynamic-attributes"); - if (dynamicAttrsMapName != null) { - checkUniqueName(dynamicAttrsMapName, TAG_DYNAMIC, n); - } - smallIcon = checkConflict(n, smallIcon, "small-icon"); - largeIcon = checkConflict(n, largeIcon, "large-icon"); - description = checkConflict(n, description, "description"); - displayName = checkConflict(n, displayName, "display-name"); - example = checkConflict(n, example, "example"); - } - - private String checkConflict(Node n, String oldAttrValue, String attr) - throws JasperException { - - String result = oldAttrValue; - String attrValue = n.getAttributeValue(attr); - if (attrValue != null) { - if (oldAttrValue != null && !oldAttrValue.equals(attrValue)) { - err.jspError(n, "jsp.error.tag.conflict.attr", attr, - oldAttrValue, attrValue); - } - result = attrValue; - } - return result; - } - - public void visit(Node.AttributeDirective n) throws JasperException { - - JspUtil.checkAttributes("Attribute directive", n, - attributeDirectiveAttrs, err); - - // JSP 2.1 Table JSP.8-3 - // handle deferredValue and deferredValueType - boolean deferredValue = false; - boolean deferredValueSpecified = false; - String deferredValueString = n.getAttributeValue("deferredValue"); - if (deferredValueString != null) { - deferredValueSpecified = true; - deferredValue = JspUtil.booleanValue(deferredValueString); - } - String deferredValueType = n.getAttributeValue("deferredValueType"); - if (deferredValueType != null) { - if (deferredValueSpecified && !deferredValue) { - err.jspError(n, "jsp.error.deferredvaluetypewithoutdeferredvalue"); - } else { - deferredValue = true; - } - } else if (deferredValue) { - deferredValueType = "java.lang.Object"; - } else { - deferredValueType = "java.lang.String"; - } - - // JSP 2.1 Table JSP.8-3 - // handle deferredMethod and deferredMethodSignature - boolean deferredMethod = false; - boolean deferredMethodSpecified = false; - String deferredMethodString = n.getAttributeValue("deferredMethod"); - if (deferredMethodString != null) { - deferredMethodSpecified = true; - deferredMethod = JspUtil.booleanValue(deferredMethodString); - } - String deferredMethodSignature = n - .getAttributeValue("deferredMethodSignature"); - if (deferredMethodSignature != null) { - if (deferredMethodSpecified && !deferredMethod) { - err.jspError(n, "jsp.error.deferredmethodsignaturewithoutdeferredmethod"); - } else { - deferredMethod = true; - } - } else if (deferredMethod) { - deferredMethodSignature = "void methodname()"; - } - - if (deferredMethod && deferredValue) { - err.jspError(n, "jsp.error.deferredmethodandvalue"); - } - - String attrName = n.getAttributeValue("name"); - boolean required = JspUtil.booleanValue(n - .getAttributeValue("required")); - boolean rtexprvalue = true; - String rtexprvalueString = n.getAttributeValue("rtexprvalue"); - if (rtexprvalueString != null) { - rtexprvalue = JspUtil.booleanValue(rtexprvalueString); - } - boolean fragment = JspUtil.booleanValue(n - .getAttributeValue("fragment")); - String type = n.getAttributeValue("type"); - if (fragment) { - // type is fixed to "JspFragment" and a translation error - // must occur if specified. - if (type != null) { - err.jspError(n, "jsp.error.fragmentwithtype"); - } - // rtexprvalue is fixed to "true" and a translation error - // must occur if specified. - rtexprvalue = true; - if (rtexprvalueString != null) { - err.jspError(n, "jsp.error.frgmentwithrtexprvalue"); - } - } else { - if (type == null) - type = "java.lang.String"; - - if (deferredValue) { - type = ValueExpression.class.getName(); - } else if (deferredMethod) { - type = MethodExpression.class.getName(); - } - } - - if (("2.0".equals(tagLibInfo.getRequiredVersion()) || ("1.2".equals(tagLibInfo.getRequiredVersion()))) - && (deferredMethodSpecified || deferredMethod - || deferredValueSpecified || deferredValue)) { - err.jspError("jsp.error.invalid.version", path); - } - - TagAttributeInfo tagAttributeInfo = new TagAttributeInfo(attrName, - required, type, rtexprvalue, fragment, null, deferredValue, - deferredMethod, deferredValueType, deferredMethodSignature); - attributeVector.addElement(tagAttributeInfo); - checkUniqueName(attrName, ATTR_NAME, n, tagAttributeInfo); - } - - public void visit(Node.VariableDirective n) throws JasperException { - - JspUtil.checkAttributes("Variable directive", n, - variableDirectiveAttrs, err); - - String nameGiven = n.getAttributeValue("name-given"); - String nameFromAttribute = n - .getAttributeValue("name-from-attribute"); - if (nameGiven == null && nameFromAttribute == null) { - err.jspError("jsp.error.variable.either.name"); - } - - if (nameGiven != null && nameFromAttribute != null) { - err.jspError("jsp.error.variable.both.name"); - } - - String alias = n.getAttributeValue("alias"); - if (nameFromAttribute != null && alias == null - || nameFromAttribute == null && alias != null) { - err.jspError("jsp.error.variable.alias"); - } - - String className = n.getAttributeValue("variable-class"); - if (className == null) - className = "java.lang.String"; - - String declareStr = n.getAttributeValue("declare"); - boolean declare = true; - if (declareStr != null) - declare = JspUtil.booleanValue(declareStr); - - int scope = VariableInfo.NESTED; - String scopeStr = n.getAttributeValue("scope"); - if (scopeStr != null) { - if ("NESTED".equals(scopeStr)) { - // Already the default - } else if ("AT_BEGIN".equals(scopeStr)) { - scope = VariableInfo.AT_BEGIN; - } else if ("AT_END".equals(scopeStr)) { - scope = VariableInfo.AT_END; - } - } - - if (nameFromAttribute != null) { - /* - * An alias has been specified. We use 'nameGiven' to hold the - * value of the alias, and 'nameFromAttribute' to hold the name - * of the attribute whose value (at invocation-time) denotes the - * name of the variable that is being aliased - */ - nameGiven = alias; - checkUniqueName(nameFromAttribute, VAR_NAME_FROM, n); - checkUniqueName(alias, VAR_ALIAS, n); - } else { - // name-given specified - checkUniqueName(nameGiven, VAR_NAME_GIVEN, n); - } - - variableVector.addElement(new TagVariableInfo(nameGiven, - nameFromAttribute, className, declare, scope)); - } - - /* - * Returns the vector of attributes corresponding to attribute - * directives. - */ - public Vector getAttributesVector() { - return attributeVector; - } - - /* - * Returns the vector of variables corresponding to variable directives. - */ - public Vector getVariablesVector() { - return variableVector; - } - - /* - * Returns the value of the dynamic-attributes tag directive attribute. - */ - public String getDynamicAttributesMapName() { - return dynamicAttrsMapName; - } - - public TagInfo getTagInfo() throws JasperException { - - if (name == null) { - // XXX Get it from tag file name - } - - if (bodycontent == null) { - bodycontent = TagInfo.BODY_CONTENT_SCRIPTLESS; - } - - String tagClassName = JspUtil.getTagHandlerClassName( - path, tagLibInfo.getReliableURN(), err); - - TagVariableInfo[] tagVariableInfos = new TagVariableInfo[variableVector - .size()]; - variableVector.copyInto(tagVariableInfos); - - TagAttributeInfo[] tagAttributeInfo = new TagAttributeInfo[attributeVector - .size()]; - attributeVector.copyInto(tagAttributeInfo); - - return new JasperTagInfo(name, tagClassName, bodycontent, - description, tagLibInfo, tei, tagAttributeInfo, - displayName, smallIcon, largeIcon, tagVariableInfos, - dynamicAttrsMapName); - } - - static class NameEntry { - private String type; - - private Node node; - - private TagAttributeInfo attr; - - NameEntry(String type, Node node, TagAttributeInfo attr) { - this.type = type; - this.node = node; - this.attr = attr; - } - - String getType() { - return type; - } - - Node getNode() { - return node; - } - - TagAttributeInfo getTagAttributeInfo() { - return attr; - } - } - - /** - * Reports a translation error if names specified in attributes of - * directives are not unique in this translation unit. - * - * The value of the following attributes must be unique. 1. 'name' - * attribute of an attribute directive 2. 'name-given' attribute of a - * variable directive 3. 'alias' attribute of variable directive 4. - * 'dynamic-attributes' of a tag directive except that - * 'dynamic-attributes' can (and must) have the same value when it - * appears in multiple tag directives. - * - * Also, 'name-from' attribute of a variable directive cannot have the - * same value as that from another variable directive. - */ - private void checkUniqueName(String name, String type, Node n) - throws JasperException { - checkUniqueName(name, type, n, null); - } - - private void checkUniqueName(String name, String type, Node n, - TagAttributeInfo attr) throws JasperException { - - HashMap table = (type == VAR_NAME_FROM) ? nameFromTable : nameTable; - NameEntry nameEntry = (NameEntry) table.get(name); - if (nameEntry != null) { - if (type != TAG_DYNAMIC || nameEntry.getType() != TAG_DYNAMIC) { - int line = nameEntry.getNode().getStart().getLineNumber(); - err.jspError(n, "jsp.error.tagfile.nameNotUnique", type, - nameEntry.getType(), Integer.toString(line)); - } - } else { - table.put(name, new NameEntry(type, n, attr)); - } - } - - /** - * Perform miscellean checks after the nodes are visited. - */ - void postCheck() throws JasperException { - // Check that var.name-from-attributes has valid values. - Iterator iter = nameFromTable.keySet().iterator(); - while (iter.hasNext()) { - String nameFrom = (String) iter.next(); - NameEntry nameEntry = (NameEntry) nameTable.get(nameFrom); - NameEntry nameFromEntry = (NameEntry) nameFromTable - .get(nameFrom); - Node nameFromNode = nameFromEntry.getNode(); - if (nameEntry == null) { - err.jspError(nameFromNode, - "jsp.error.tagfile.nameFrom.noAttribute", nameFrom); - } else { - Node node = nameEntry.getNode(); - TagAttributeInfo tagAttr = nameEntry.getTagAttributeInfo(); - if (!"java.lang.String".equals(tagAttr.getTypeName()) - || !tagAttr.isRequired() - || tagAttr.canBeRequestTime()) { - err.jspError(nameFromNode, - "jsp.error.tagfile.nameFrom.badAttribute", - nameFrom, Integer.toString(node.getStart() - .getLineNumber())); - } - } - } - } - } - - /** - * Parses the tag file, and collects information on the directives included - * in it. The method is used to obtain the info on the tag file, when the - * handler that it represents is referenced. The tag file is not compiled - * here. - * - * @param pc - * the current ParserController used in this compilation - * @param name - * the tag name as specified in the TLD - * @param tagfile - * the path for the tagfile - * @param tagLibInfo - * the TagLibraryInfo object associated with this TagInfo - * @return a TagInfo object assembled from the directives in the tag file. - * @deprecated Use {@link TagFileProcessor#parseTagFileDirectives( - * ParserController, String, String, URL, TagLibraryInfo)} - * See https://issues.apache.org/bugzilla/show_bug.cgi?id=46471 - */ - public static TagInfo parseTagFileDirectives(ParserController pc, - String name, String path, TagLibraryInfo tagLibInfo) - throws JasperException { - return parseTagFileDirectives(pc, name, path, - pc.getJspCompilationContext().getTagFileJarUrl(path), - tagLibInfo); - } - - /** - * Parses the tag file, and collects information on the directives included - * in it. The method is used to obtain the info on the tag file, when the - * handler that it represents is referenced. The tag file is not compiled - * here. - * - * @param pc - * the current ParserController used in this compilation - * @param name - * the tag name as specified in the TLD - * @param tagfile - * the path for the tagfile - * @param tagFileJarUrl - * the url for the Jar containign the tag file - * @param tagLibInfo - * the TagLibraryInfo object associated with this TagInfo - * @return a TagInfo object assembled from the directives in the tag file. - */ - public static TagInfo parseTagFileDirectives(ParserController pc, - String name, String path, URL tagFileJarUrl, TagLibraryInfo tagLibInfo) - throws JasperException { - - ErrorDispatcher err = pc.getCompiler().getErrorDispatcher(); - - Node.Nodes page = null; - try { - page = pc.parseTagFileDirectives(path, tagFileJarUrl); - } catch (FileNotFoundException e) { - err.jspError("jsp.error.file.not.found", path); - } catch (IOException e) { - err.jspError("jsp.error.file.not.found", path); - } - - TagFileDirectiveVisitor tagFileVisitor = new TagFileDirectiveVisitor(pc - .getCompiler(), tagLibInfo, name, path); - page.visit(tagFileVisitor); - tagFileVisitor.postCheck(); - - return tagFileVisitor.getTagInfo(); - } - - /** - * Compiles and loads a tagfile. - */ - private Class loadTagFile(Compiler compiler, String tagFilePath, - TagInfo tagInfo, PageInfo parentPageInfo) throws JasperException { - - URL tagFileJarUrl = null; - if (tagFilePath.startsWith("/META-INF/")) { - try { - tagFileJarUrl = new URL("jar:" + - compiler.getCompilationContext().getTldLocation( - tagInfo.getTagLibrary().getURI())[0] + "!/"); - } catch (MalformedURLException e) { - // Ignore - tagFileJarUrl will be null - } - } - String tagFileJarPath; - if (tagFileJarUrl == null) { - tagFileJarPath = ""; - } else { - tagFileJarPath = tagFileJarUrl.toString(); - } - - JspCompilationContext ctxt = compiler.getCompilationContext(); - JspRuntimeContext rctxt = ctxt.getRuntimeContext(); - JspServletWrapper wrapper = rctxt.getWrapper(tagFileJarPath + tagFilePath); - - synchronized (rctxt) { - if (wrapper == null) { - wrapper = new JspServletWrapper(ctxt.getServletContext(), ctxt - .getOptions(), tagFilePath, tagInfo, ctxt - .getRuntimeContext(), tagFileJarUrl); - rctxt.addWrapper(tagFileJarPath + tagFilePath, wrapper); - - // Use same classloader and classpath for compiling tag files - wrapper.getJspEngineContext().setClassLoader( - (URLClassLoader) ctxt.getClassLoader()); - wrapper.getJspEngineContext().setClassPath(ctxt.getClassPath()); - } else { - // Make sure that JspCompilationContext gets the latest TagInfo - // for the tag file. TagInfo instance was created the last - // time the tag file was scanned for directives, and the tag - // file may have been modified since then. - wrapper.getJspEngineContext().setTagInfo(tagInfo); - } - - Class tagClazz; - int tripCount = wrapper.incTripCount(); - try { - if (tripCount > 0) { - // When tripCount is greater than zero, a circular - // dependency exists. The circularily dependant tag - // file is compiled in prototype mode, to avoid infinite - // recursion. - - JspServletWrapper tempWrapper = new JspServletWrapper(ctxt - .getServletContext(), ctxt.getOptions(), - tagFilePath, tagInfo, ctxt.getRuntimeContext(), - ctxt.getTagFileJarUrl(tagFilePath)); - tagClazz = tempWrapper.loadTagFilePrototype(); - tempVector.add(tempWrapper.getJspEngineContext() - .getCompiler()); - } else { - tagClazz = wrapper.loadTagFile(); - } - } finally { - wrapper.decTripCount(); - } - - // Add the dependants for this tag file to its parent's - // dependant list. The only reliable dependency information - // can only be obtained from the tag instance. - try { - Object tagIns = tagClazz.newInstance(); - if (tagIns instanceof JspSourceDependent) { - Iterator iter = ((List) ((JspSourceDependent) tagIns) - .getDependants()).iterator(); - while (iter.hasNext()) { - parentPageInfo.addDependant((String) iter.next()); - } - } - } catch (Exception e) { - // ignore errors - } - - return tagClazz; - } - } - - /* - * Visitor which scans the page and looks for tag handlers that are tag - * files, compiling (if necessary) and loading them. - */ - private class TagFileLoaderVisitor extends Node.Visitor { - - private Compiler compiler; - - private PageInfo pageInfo; - - TagFileLoaderVisitor(Compiler compiler) { - - this.compiler = compiler; - this.pageInfo = compiler.getPageInfo(); - } - - public void visit(Node.CustomTag n) throws JasperException { - TagFileInfo tagFileInfo = n.getTagFileInfo(); - if (tagFileInfo != null) { - String tagFilePath = tagFileInfo.getPath(); - if (tagFilePath.startsWith("/META-INF/")) { - // For tags in JARs, add the TLD and the tag as a dependency - String[] location = - compiler.getCompilationContext().getTldLocation( - tagFileInfo.getTagInfo().getTagLibrary().getURI()); - // Add TLD - pageInfo.addDependant("jar:" + location[0] + "!/" + - location[1]); - // Add Tag - pageInfo.addDependant("jar:" + location[0] + "!" + - tagFilePath); - } else { - pageInfo.addDependant(tagFilePath); - } - Class c = loadTagFile(compiler, tagFilePath, n.getTagInfo(), - pageInfo); - n.setTagHandlerClass(c); - } - visitBody(n); - } - } - - /** - * Implements a phase of the translation that compiles (if necessary) the - * tag files used in a JSP files. The directives in the tag files are - * assumed to have been proccessed and encapsulated as TagFileInfo in the - * CustomTag nodes. - */ - public void loadTagFiles(Compiler compiler, Node.Nodes page) - throws JasperException { - - tempVector = new Vector(); - page.visit(new TagFileLoaderVisitor(compiler)); - } - - /** - * Removed the java and class files for the tag prototype generated from the - * current compilation. - * - * @param classFileName - * If non-null, remove only the class file with with this name. - */ - public void removeProtoTypeFiles(String classFileName) { - Iterator iter = tempVector.iterator(); - while (iter.hasNext()) { - Compiler c = (Compiler) iter.next(); - if (classFileName == null) { - c.removeGeneratedClassFiles(); - } else if (classFileName.equals(c.getCompilationContext() - .getClassFileName())) { - c.removeGeneratedClassFiles(); - tempVector.remove(c); - return; - } - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagLibraryInfoImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagLibraryInfoImpl.java deleted file mode 100644 index 7c0291d7d..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagLibraryInfoImpl.java +++ /dev/null @@ -1,768 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.FileInputStream; -import java.io.FileNotFoundException; -import java.io.InputStream; -import java.io.PrintWriter; -import java.io.StringWriter; -import java.net.JarURLConnection; -import java.net.URL; -import java.util.Collection; -import java.util.Enumeration; -import java.util.Hashtable; -import java.util.Iterator; -import java.util.Map; -import java.util.Vector; -import java.util.jar.JarFile; -import java.util.zip.ZipEntry; - -import javax.servlet.jsp.tagext.FunctionInfo; -import javax.servlet.jsp.tagext.PageData; -import javax.servlet.jsp.tagext.TagAttributeInfo; -import javax.servlet.jsp.tagext.TagExtraInfo; -import javax.servlet.jsp.tagext.TagFileInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagLibraryInfo; -import javax.servlet.jsp.tagext.TagLibraryValidator; -import javax.servlet.jsp.tagext.TagVariableInfo; -import javax.servlet.jsp.tagext.ValidationMessage; -import javax.servlet.jsp.tagext.VariableInfo; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.xmlparser.ParserUtils; -import org.apache.jasper.xmlparser.TreeNode; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * Implementation of the TagLibraryInfo class from the JSP spec. - * - * @author Anil K. Vijendran - * @author Mandar Raje - * @author Pierre Delisle - * @author Kin-man Chung - * @author Jan Luehe - */ -class TagLibraryInfoImpl extends TagLibraryInfo implements TagConstants { - - // Logger - private Log log = LogFactory.getLog(TagLibraryInfoImpl.class); - - private JspCompilationContext ctxt; - - private PageInfo pi; - - private ErrorDispatcher err; - - private ParserController parserController; - - private final void print(String name, String value, PrintWriter w) { - if (value != null) { - w.print(name + " = {\n\t"); - w.print(value); - w.print("\n}\n"); - } - } - - public String toString() { - StringWriter sw = new StringWriter(); - PrintWriter out = new PrintWriter(sw); - print("tlibversion", tlibversion, out); - print("jspversion", jspversion, out); - print("shortname", shortname, out); - print("urn", urn, out); - print("info", info, out); - print("uri", uri, out); - print("tagLibraryValidator", "" + tagLibraryValidator, out); - - for (int i = 0; i < tags.length; i++) - out.println(tags[i].toString()); - - for (int i = 0; i < tagFiles.length; i++) - out.println(tagFiles[i].toString()); - - for (int i = 0; i < functions.length; i++) - out.println(functions[i].toString()); - - return sw.toString(); - } - - // XXX FIXME - // resolveRelativeUri and/or getResourceAsStream don't seem to properly - // handle relative paths when dealing when home and getDocBase are set - // the following is a workaround until these problems are resolved. - private InputStream getResourceAsStream(String uri) - throws FileNotFoundException { - try { - // see if file exists on the filesystem first - String real = ctxt.getRealPath(uri); - if (real == null) { - return ctxt.getResourceAsStream(uri); - } else { - return new FileInputStream(real); - } - } catch (FileNotFoundException ex) { - // if file not found on filesystem, get the resource through - // the context - return ctxt.getResourceAsStream(uri); - } - - } - - /** - * Constructor. - */ - public TagLibraryInfoImpl(JspCompilationContext ctxt, ParserController pc, PageInfo pi, - String prefix, String uriIn, String[] location, ErrorDispatcher err) - throws JasperException { - super(prefix, uriIn); - - this.ctxt = ctxt; - this.parserController = pc; - this.pi = pi; - this.err = err; - InputStream in = null; - JarFile jarFile = null; - - if (location == null) { - // The URI points to the TLD itself or to a JAR file in which the - // TLD is stored - location = generateTLDLocation(uri, ctxt); - } - - try { - if (!location[0].endsWith("jar")) { - // Location points to TLD file - try { - in = getResourceAsStream(location[0]); - if (in == null) { - throw new FileNotFoundException(location[0]); - } - } catch (FileNotFoundException ex) { - err.jspError("jsp.error.file.not.found", location[0]); - } - - parseTLD(ctxt, location[0], in, null); - // Add TLD to dependency list - PageInfo pageInfo = ctxt.createCompiler().getPageInfo(); - if (pageInfo != null) { - pageInfo.addDependant(location[0]); - } - } else { - // Tag library is packaged in JAR file - try { - URL jarFileUrl = new URL("jar:" + location[0] + "!/"); - JarURLConnection conn = (JarURLConnection) jarFileUrl - .openConnection(); - conn.setUseCaches(false); - conn.connect(); - jarFile = conn.getJarFile(); - ZipEntry jarEntry = jarFile.getEntry(location[1]); - in = jarFile.getInputStream(jarEntry); - parseTLD(ctxt, location[0], in, jarFileUrl); - } catch (Exception ex) { - err.jspError("jsp.error.tld.unable_to_read", location[0], - location[1], ex.toString()); - } - } - } finally { - if (in != null) { - try { - in.close(); - } catch (Throwable t) { - } - } - if (jarFile != null) { - try { - jarFile.close(); - } catch (Throwable t) { - } - } - } - - } - - public TagLibraryInfo[] getTagLibraryInfos() { - Collection coll = pi.getTaglibs(); - return (TagLibraryInfo[]) coll.toArray(new TagLibraryInfo[0]); - } - - /* - * @param ctxt The JSP compilation context @param uri The TLD's uri @param - * in The TLD's input stream @param jarFileUrl The JAR file containing the - * TLD, or null if the tag library is not packaged in a JAR - */ - private void parseTLD(JspCompilationContext ctxt, String uri, - InputStream in, URL jarFileUrl) throws JasperException { - Vector tagVector = new Vector(); - Vector tagFileVector = new Vector(); - Hashtable functionTable = new Hashtable(); - - // Create an iterator over the child elements of our element - ParserUtils pu = new ParserUtils(); - TreeNode tld = pu.parseXMLDocument(uri, in); - - // Check to see if the root element contains a 'version' - // attribute, which was added in JSP 2.0 to replace the - // subelement - this.jspversion = tld.findAttribute("version"); - - // Process each child element of our element - Iterator list = tld.findChildren(); - - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - - if ("tlibversion".equals(tname) // JSP 1.1 - || "tlib-version".equals(tname)) { // JSP 1.2 - this.tlibversion = element.getBody(); - } else if ("jspversion".equals(tname) - || "jsp-version".equals(tname)) { - this.jspversion = element.getBody(); - } else if ("shortname".equals(tname) || "short-name".equals(tname)) - this.shortname = element.getBody(); - else if ("uri".equals(tname)) - this.urn = element.getBody(); - else if ("info".equals(tname) || "description".equals(tname)) - this.info = element.getBody(); - else if ("validator".equals(tname)) - this.tagLibraryValidator = createValidator(element); - else if ("tag".equals(tname)) - tagVector.addElement(createTagInfo(element, jspversion)); - else if ("tag-file".equals(tname)) { - TagFileInfo tagFileInfo = createTagFileInfo(element, uri, - jarFileUrl); - tagFileVector.addElement(tagFileInfo); - } else if ("function".equals(tname)) { // JSP2.0 - FunctionInfo funcInfo = createFunctionInfo(element); - String funcName = funcInfo.getName(); - if (functionTable.containsKey(funcName)) { - err.jspError("jsp.error.tld.fn.duplicate.name", funcName, - uri); - - } - functionTable.put(funcName, funcInfo); - } else if ("display-name".equals(tname) || // Ignored elements - "small-icon".equals(tname) || "large-icon".equals(tname) - || "listener".equals(tname)) { - ; - } else if ("taglib-extension".equals(tname)) { - // Recognized but ignored - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.taglib", tname)); - } - } - - } - - if (tlibversion == null) { - err.jspError("jsp.error.tld.mandatory.element.missing", - "tlib-version"); - } - if (jspversion == null) { - err.jspError("jsp.error.tld.mandatory.element.missing", - "jsp-version"); - } - - this.tags = new TagInfo[tagVector.size()]; - tagVector.copyInto(this.tags); - - this.tagFiles = new TagFileInfo[tagFileVector.size()]; - tagFileVector.copyInto(this.tagFiles); - - this.functions = new FunctionInfo[functionTable.size()]; - int i = 0; - Enumeration enumeration = functionTable.elements(); - while (enumeration.hasMoreElements()) { - this.functions[i++] = (FunctionInfo) enumeration.nextElement(); - } - } - - /* - * @param uri The uri of the TLD @param ctxt The compilation context - * - * @return String array whose first element denotes the path to the TLD. If - * the path to the TLD points to a jar file, then the second element denotes - * the name of the TLD entry in the jar file, which is hardcoded to - * META-INF/taglib.tld. - */ - private String[] generateTLDLocation(String uri, JspCompilationContext ctxt) - throws JasperException { - - int uriType = TldLocationsCache.uriType(uri); - if (uriType == TldLocationsCache.ABS_URI) { - err.jspError("jsp.error.taglibDirective.absUriCannotBeResolved", - uri); - } else if (uriType == TldLocationsCache.NOROOT_REL_URI) { - uri = ctxt.resolveRelativeUri(uri); - } - - String[] location = new String[2]; - location[0] = uri; - if (location[0].endsWith("jar")) { - URL url = null; - try { - url = ctxt.getResource(location[0]); - } catch (Exception ex) { - err.jspError("jsp.error.tld.unable_to_get_jar", location[0], ex - .toString()); - } - if (url == null) { - err.jspError("jsp.error.tld.missing_jar", location[0]); - } - location[0] = url.toString(); - location[1] = "META-INF/taglib.tld"; - } - - return location; - } - - private TagInfo createTagInfo(TreeNode elem, String jspVersion) - throws JasperException { - - String tagName = null; - String tagClassName = null; - String teiClassName = null; - - /* - * Default body content for JSP 1.2 tag handlers ( has - * become mandatory in JSP 2.0, because the default would be invalid for - * simple tag handlers) - */ - String bodycontent = "JSP"; - - String info = null; - String displayName = null; - String smallIcon = null; - String largeIcon = null; - boolean dynamicAttributes = false; - - Vector attributeVector = new Vector(); - Vector variableVector = new Vector(); - Iterator list = elem.findChildren(); - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - - if ("name".equals(tname)) { - tagName = element.getBody(); - } else if ("tagclass".equals(tname) || "tag-class".equals(tname)) { - tagClassName = element.getBody(); - } else if ("teiclass".equals(tname) || "tei-class".equals(tname)) { - teiClassName = element.getBody(); - } else if ("bodycontent".equals(tname) - || "body-content".equals(tname)) { - bodycontent = element.getBody(); - } else if ("display-name".equals(tname)) { - displayName = element.getBody(); - } else if ("small-icon".equals(tname)) { - smallIcon = element.getBody(); - } else if ("large-icon".equals(tname)) { - largeIcon = element.getBody(); - } else if ("icon".equals(tname)) { - TreeNode icon = element.findChild("small-icon"); - if (icon != null) { - smallIcon = icon.getBody(); - } - icon = element.findChild("large-icon"); - if (icon != null) { - largeIcon = icon.getBody(); - } - } else if ("info".equals(tname) || "description".equals(tname)) { - info = element.getBody(); - } else if ("variable".equals(tname)) { - variableVector.addElement(createVariable(element)); - } else if ("attribute".equals(tname)) { - attributeVector - .addElement(createAttribute(element, jspVersion)); - } else if ("dynamic-attributes".equals(tname)) { - dynamicAttributes = JspUtil.booleanValue(element.getBody()); - } else if ("example".equals(tname)) { - // Ignored elements - } else if ("tag-extension".equals(tname)) { - // Ignored - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.tag", tname)); - } - } - } - - TagExtraInfo tei = null; - if (teiClassName != null && !teiClassName.equals("")) { - try { - Class teiClass = ctxt.getClassLoader().loadClass(teiClassName); - tei = (TagExtraInfo) teiClass.newInstance(); - } catch (Exception e) { - err.jspError("jsp.error.teiclass.instantiation", teiClassName, - e); - } - } - - TagAttributeInfo[] tagAttributeInfo = new TagAttributeInfo[attributeVector - .size()]; - attributeVector.copyInto(tagAttributeInfo); - - TagVariableInfo[] tagVariableInfos = new TagVariableInfo[variableVector - .size()]; - variableVector.copyInto(tagVariableInfos); - - TagInfo taginfo = new TagInfo(tagName, tagClassName, bodycontent, info, - this, tei, tagAttributeInfo, displayName, smallIcon, largeIcon, - tagVariableInfos, dynamicAttributes); - return taginfo; - } - - /* - * Parses the tag file directives of the given TagFile and turns them into a - * TagInfo. - * - * @param elem The element in the TLD @param uri The location of - * the TLD, in case the tag file is specified relative to it @param jarFile - * The JAR file, in case the tag file is packaged in a JAR - * - * @return TagInfo correspoding to tag file directives - */ - private TagFileInfo createTagFileInfo(TreeNode elem, String uri, - URL jarFileUrl) throws JasperException { - - String name = null; - String path = null; - - Iterator list = elem.findChildren(); - while (list.hasNext()) { - TreeNode child = (TreeNode) list.next(); - String tname = child.getName(); - if ("name".equals(tname)) { - name = child.getBody(); - } else if ("path".equals(tname)) { - path = child.getBody(); - } else if ("example".equals(tname)) { - // Ignore element: Bugzilla 33538 - } else if ("tag-extension".equals(tname)) { - // Ignore element: Bugzilla 33538 - } else if ("icon".equals(tname) - || "display-name".equals(tname) - || "description".equals(tname)) { - // Ignore these elements: Bugzilla 38015 - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.tagfile", tname)); - } - } - } - - if (path.startsWith("/META-INF/tags")) { - // Tag file packaged in JAR - // See https://issues.apache.org/bugzilla/show_bug.cgi?id=46471 - // This needs to be removed once all the broken code that depends on - // it has been removed - ctxt.setTagFileJarUrl(path, jarFileUrl); - } else if (!path.startsWith("/WEB-INF/tags")) { - err.jspError("jsp.error.tagfile.illegalPath", path); - } - - TagInfo tagInfo = TagFileProcessor.parseTagFileDirectives( - parserController, name, path, jarFileUrl, this); - return new TagFileInfo(name, path, tagInfo); - } - - TagAttributeInfo createAttribute(TreeNode elem, String jspVersion) { - String name = null; - String type = null; - String expectedType = null; - String methodSignature = null; - boolean required = false, rtexprvalue = false, reqTime = false, isFragment = false, deferredValue = false, deferredMethod = false; - - Iterator list = elem.findChildren(); - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - - if ("name".equals(tname)) { - name = element.getBody(); - } else if ("required".equals(tname)) { - String s = element.getBody(); - if (s != null) - required = JspUtil.booleanValue(s); - } else if ("rtexprvalue".equals(tname)) { - String s = element.getBody(); - if (s != null) - rtexprvalue = JspUtil.booleanValue(s); - } else if ("type".equals(tname)) { - type = element.getBody(); - if ("1.2".equals(jspVersion) - && (type.equals("Boolean") || type.equals("Byte") - || type.equals("Character") - || type.equals("Double") - || type.equals("Float") - || type.equals("Integer") - || type.equals("Long") || type.equals("Object") - || type.equals("Short") || type - .equals("String"))) { - type = "java.lang." + type; - } - } else if ("fragment".equals(tname)) { - String s = element.getBody(); - if (s != null) { - isFragment = JspUtil.booleanValue(s); - } - } else if ("deferred-value".equals(tname)) { - deferredValue = true; - type = "javax.el.ValueExpression"; - TreeNode child = element.findChild("type"); - if (child != null) { - expectedType = child.getBody(); - if (expectedType != null) { - expectedType = expectedType.trim(); - } - } else { - expectedType = "java.lang.Object"; - } - } else if ("deferred-method".equals(tname)) { - deferredMethod = true; - type = "javax.el.MethodExpression"; - TreeNode child = element.findChild("method-signature"); - if (child != null) { - methodSignature = child.getBody(); - if (methodSignature != null) { - methodSignature = methodSignature.trim(); - } - } else { - methodSignature = "java.lang.Object method()"; - } - } else if ("description".equals(tname) || // Ignored elements - false) { - ; - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.attribute", tname)); - } - } - } - - if (isFragment) { - /* - * According to JSP.C-3 ("TLD Schema Element Structure - tag"), - * 'type' and 'rtexprvalue' must not be specified if 'fragment' has - * been specified (this will be enforced by validating parser). - * Also, if 'fragment' is TRUE, 'type' is fixed at - * javax.servlet.jsp.tagext.JspFragment, and 'rtexprvalue' is fixed - * at true. See also JSP.8.5.2. - */ - type = "javax.servlet.jsp.tagext.JspFragment"; - rtexprvalue = true; - } - - if (!rtexprvalue && type == null) { - // According to JSP spec, for static values (those determined at - // translation time) the type is fixed at java.lang.String. - type = "java.lang.String"; - } - - return new TagAttributeInfo(name, required, type, rtexprvalue, - isFragment, null, deferredValue, deferredMethod, expectedType, - methodSignature); - } - - TagVariableInfo createVariable(TreeNode elem) { - String nameGiven = null; - String nameFromAttribute = null; - String className = "java.lang.String"; - boolean declare = true; - int scope = VariableInfo.NESTED; - - Iterator list = elem.findChildren(); - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - if ("name-given".equals(tname)) - nameGiven = element.getBody(); - else if ("name-from-attribute".equals(tname)) - nameFromAttribute = element.getBody(); - else if ("variable-class".equals(tname)) - className = element.getBody(); - else if ("declare".equals(tname)) { - String s = element.getBody(); - if (s != null) - declare = JspUtil.booleanValue(s); - } else if ("scope".equals(tname)) { - String s = element.getBody(); - if (s != null) { - if ("NESTED".equals(s)) { - scope = VariableInfo.NESTED; - } else if ("AT_BEGIN".equals(s)) { - scope = VariableInfo.AT_BEGIN; - } else if ("AT_END".equals(s)) { - scope = VariableInfo.AT_END; - } - } - } else if ("description".equals(tname) || // Ignored elements - false) { - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.variable", tname)); - } - } - } - return new TagVariableInfo(nameGiven, nameFromAttribute, className, - declare, scope); - } - - private TagLibraryValidator createValidator(TreeNode elem) - throws JasperException { - - String validatorClass = null; - Map initParams = new Hashtable(); - - Iterator list = elem.findChildren(); - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - if ("validator-class".equals(tname)) - validatorClass = element.getBody(); - else if ("init-param".equals(tname)) { - String[] initParam = createInitParam(element); - initParams.put(initParam[0], initParam[1]); - } else if ("description".equals(tname) || // Ignored elements - false) { - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.validator", tname)); - } - } - } - - TagLibraryValidator tlv = null; - if (validatorClass != null && !validatorClass.equals("")) { - try { - Class tlvClass = ctxt.getClassLoader() - .loadClass(validatorClass); - tlv = (TagLibraryValidator) tlvClass.newInstance(); - } catch (Exception e) { - err.jspError("jsp.error.tlvclass.instantiation", - validatorClass, e); - } - } - if (tlv != null) { - tlv.setInitParameters(initParams); - } - return tlv; - } - - String[] createInitParam(TreeNode elem) { - String[] initParam = new String[2]; - - Iterator list = elem.findChildren(); - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - if ("param-name".equals(tname)) { - initParam[0] = element.getBody(); - } else if ("param-value".equals(tname)) { - initParam[1] = element.getBody(); - } else if ("description".equals(tname)) { - // Do nothing - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.initParam", tname)); - } - } - } - return initParam; - } - - FunctionInfo createFunctionInfo(TreeNode elem) { - - String name = null; - String klass = null; - String signature = null; - - Iterator list = elem.findChildren(); - while (list.hasNext()) { - TreeNode element = (TreeNode) list.next(); - String tname = element.getName(); - - if ("name".equals(tname)) { - name = element.getBody(); - } else if ("function-class".equals(tname)) { - klass = element.getBody(); - } else if ("function-signature".equals(tname)) { - signature = element.getBody(); - } else if ("display-name".equals(tname) || // Ignored elements - "small-icon".equals(tname) || "large-icon".equals(tname) - || "description".equals(tname) || "example".equals(tname)) { - } else { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.warning.unknown.element.in.function", tname)); - } - } - } - - return new FunctionInfo(name, klass, signature); - } - - // ********************************************************************* - // Until javax.servlet.jsp.tagext.TagLibraryInfo is fixed - - /** - * The instance (if any) for the TagLibraryValidator class. - * - * @return The TagLibraryValidator instance, if any. - */ - public TagLibraryValidator getTagLibraryValidator() { - return tagLibraryValidator; - } - - /** - * Translation-time validation of the XML document associated with the JSP - * page. This is a convenience method on the associated TagLibraryValidator - * class. - * - * @param thePage - * The JSP page object - * @return A string indicating whether the page is valid or not. - */ - public ValidationMessage[] validate(PageData thePage) { - TagLibraryValidator tlv = getTagLibraryValidator(); - if (tlv == null) - return null; - - String uri = getURI(); - if (uri.startsWith("/")) { - uri = URN_JSPTLD + uri; - } - - return tlv.validate(getPrefixString(), uri, thePage); - } - - protected TagLibraryValidator tagLibraryValidator; -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagPluginManager.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagPluginManager.java deleted file mode 100644 index e95d0382c..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TagPluginManager.java +++ /dev/null @@ -1,240 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.util.*; -import java.io.*; -import javax.servlet.ServletContext; - -import org.apache.jasper.JasperException; -import org.apache.jasper.xmlparser.ParserUtils; -import org.apache.jasper.xmlparser.TreeNode; -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; - -/** - * Manages tag plugin optimizations. - * @author Kin-man Chung - */ - -public class TagPluginManager { - - private static final String TAG_PLUGINS_XML = "/WEB-INF/tagPlugins.xml"; - private static final String TAG_PLUGINS_ROOT_ELEM = "tag-plugins"; - - private boolean initialized = false; - private HashMap tagPlugins = null; - private ServletContext ctxt; - private PageInfo pageInfo; - - public TagPluginManager(ServletContext ctxt) { - this.ctxt = ctxt; - } - - public void apply(Node.Nodes page, ErrorDispatcher err, PageInfo pageInfo) - throws JasperException { - - init(err); - if (tagPlugins == null || tagPlugins.size() == 0) { - return; - } - - this.pageInfo = pageInfo; - - page.visit(new Node.Visitor() { - public void visit(Node.CustomTag n) - throws JasperException { - invokePlugin(n); - visitBody(n); - } - }); - - } - - private void init(ErrorDispatcher err) throws JasperException { - if (initialized) - return; - - InputStream is = ctxt.getResourceAsStream(TAG_PLUGINS_XML); - if (is == null) - return; - - TreeNode root = (new ParserUtils()).parseXMLDocument(TAG_PLUGINS_XML, - is); - if (root == null) { - return; - } - - if (!TAG_PLUGINS_ROOT_ELEM.equals(root.getName())) { - err.jspError("jsp.error.plugin.wrongRootElement", TAG_PLUGINS_XML, - TAG_PLUGINS_ROOT_ELEM); - } - - tagPlugins = new HashMap(); - Iterator pluginList = root.findChildren("tag-plugin"); - while (pluginList.hasNext()) { - TreeNode pluginNode = (TreeNode) pluginList.next(); - TreeNode tagClassNode = pluginNode.findChild("tag-class"); - if (tagClassNode == null) { - // Error - return; - } - String tagClass = tagClassNode.getBody().trim(); - TreeNode pluginClassNode = pluginNode.findChild("plugin-class"); - if (pluginClassNode == null) { - // Error - return; - } - - String pluginClassStr = pluginClassNode.getBody(); - TagPlugin tagPlugin = null; - try { - Class pluginClass = Class.forName(pluginClassStr); - tagPlugin = (TagPlugin) pluginClass.newInstance(); - } catch (Exception e) { - throw new JasperException(e); - } - if (tagPlugin == null) { - return; - } - tagPlugins.put(tagClass, tagPlugin); - } - initialized = true; - } - - /** - * Invoke tag plugin for the given custom tag, if a plugin exists for - * the custom tag's tag handler. - * - * The given custom tag node will be manipulated by the plugin. - */ - private void invokePlugin(Node.CustomTag n) { - TagPlugin tagPlugin = (TagPlugin) - tagPlugins.get(n.getTagHandlerClass().getName()); - if (tagPlugin == null) { - return; - } - - TagPluginContext tagPluginContext = new TagPluginContextImpl(n, pageInfo); - n.setTagPluginContext(tagPluginContext); - tagPlugin.doTag(tagPluginContext); - } - - static class TagPluginContextImpl implements TagPluginContext { - private Node.CustomTag node; - private Node.Nodes curNodes; - private PageInfo pageInfo; - private HashMap pluginAttributes; - - TagPluginContextImpl(Node.CustomTag n, PageInfo pageInfo) { - this.node = n; - this.pageInfo = pageInfo; - curNodes = new Node.Nodes(); - n.setAtETag(curNodes); - curNodes = new Node.Nodes(); - n.setAtSTag(curNodes); - n.setUseTagPlugin(true); - pluginAttributes = new HashMap(); - } - - public TagPluginContext getParentContext() { - Node parent = node.getParent(); - if (! (parent instanceof Node.CustomTag)) { - return null; - } - return ((Node.CustomTag) parent).getTagPluginContext(); - } - - public void setPluginAttribute(String key, Object value) { - pluginAttributes.put(key, value); - } - - public Object getPluginAttribute(String key) { - return pluginAttributes.get(key); - } - - public boolean isScriptless() { - return node.getChildInfo().isScriptless(); - } - - public boolean isConstantAttribute(String attribute) { - Node.JspAttribute attr = getNodeAttribute(attribute); - if (attr == null) - return false; - return attr.isLiteral(); - } - - public String getConstantAttribute(String attribute) { - Node.JspAttribute attr = getNodeAttribute(attribute); - if (attr == null) - return null; - return attr.getValue(); - } - - public boolean isAttributeSpecified(String attribute) { - return getNodeAttribute(attribute) != null; - } - - public String getTemporaryVariableName() { - return node.getRoot().nextTemporaryVariableName(); - } - - public void generateImport(String imp) { - pageInfo.addImport(imp); - } - - public void generateDeclaration(String id, String text) { - if (pageInfo.isPluginDeclared(id)) { - return; - } - curNodes.add(new Node.Declaration(text, node.getStart(), null)); - } - - public void generateJavaSource(String sourceCode) { - curNodes.add(new Node.Scriptlet(sourceCode, node.getStart(), - null)); - } - - public void generateAttribute(String attributeName) { - curNodes.add(new Node.AttributeGenerator(node.getStart(), - attributeName, - node)); - } - - public void dontUseTagPlugin() { - node.setUseTagPlugin(false); - } - - public void generateBody() { - // Since we'll generate the body anyway, this is really a nop, - // except for the fact that it lets us put the Java sources the - // plugins produce in the correct order (w.r.t the body). - curNodes = node.getAtETag(); - } - - private Node.JspAttribute getNodeAttribute(String attribute) { - Node.JspAttribute[] attrs = node.getJspAttributes(); - for (int i=0; attrs != null && i < attrs.length; i++) { - if (attrs[i].getName().equals(attribute)) { - return attrs[i]; - } - } - return null; - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TextOptimizer.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TextOptimizer.java deleted file mode 100644 index 82df5216f..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TextOptimizer.java +++ /dev/null @@ -1,115 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.compiler; - -import org.apache.jasper.JasperException; -import org.apache.jasper.Options; - -/** - */ -public class TextOptimizer { - - /** - * A visitor to concatenate contiguous template texts. - */ - static class TextCatVisitor extends Node.Visitor { - - private Options options; - private PageInfo pageInfo; - private int textNodeCount = 0; - private Node.TemplateText firstTextNode = null; - private StringBuffer textBuffer; - private final String emptyText = new String(""); - - public TextCatVisitor(Compiler compiler) { - options = compiler.getCompilationContext().getOptions(); - pageInfo = compiler.getPageInfo(); - } - - public void doVisit(Node n) throws JasperException { - collectText(); - } - - /* - * The following directis are ignored in text concatenation - */ - - public void visit(Node.PageDirective n) throws JasperException { - } - - public void visit(Node.TagDirective n) throws JasperException { - } - - public void visit(Node.TaglibDirective n) throws JasperException { - } - - public void visit(Node.AttributeDirective n) throws JasperException { - } - - public void visit(Node.VariableDirective n) throws JasperException { - } - - /* - * Don't concatenate text across body boundaries - */ - public void visitBody(Node n) throws JasperException { - super.visitBody(n); - collectText(); - } - - public void visit(Node.TemplateText n) throws JasperException { - if ((options.getTrimSpaces() || pageInfo.isTrimDirectiveWhitespaces()) - && n.isAllSpace()) { - n.setText(emptyText); - return; - } - - if (textNodeCount++ == 0) { - firstTextNode = n; - textBuffer = new StringBuffer(n.getText()); - } else { - // Append text to text buffer - textBuffer.append(n.getText()); - n.setText(emptyText); - } - } - - /** - * This method breaks concatenation mode. As a side effect it copies - * the concatenated string to the first text node - */ - private void collectText() { - - if (textNodeCount > 1) { - // Copy the text in buffer into the first template text node. - firstTextNode.setText(textBuffer.toString()); - } - textNodeCount = 0; - } - - } - - public static void concatenate(Compiler compiler, Node.Nodes page) - throws JasperException { - - TextCatVisitor v = new TextCatVisitor(compiler); - page.visit(v); - - // Cleanup, in case the page ends with a template text - v.collectText(); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TldLocationsCache.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TldLocationsCache.java deleted file mode 100644 index 023bb0c5b..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/TldLocationsCache.java +++ /dev/null @@ -1,549 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.io.InputStream; -import java.net.JarURLConnection; -import java.net.MalformedURLException; -import java.net.URL; -import java.net.URLClassLoader; -import java.net.URLConnection; -import java.util.Enumeration; -import java.util.Hashtable; -import java.util.HashSet; -import java.util.Iterator; -import java.util.Set; -import java.util.StringTokenizer; -import java.util.jar.JarEntry; -import java.util.jar.JarFile; -import org.xml.sax.InputSource; - -import javax.servlet.ServletContext; - -import org.apache.jasper.Constants; -import org.apache.jasper.JasperException; -import org.apache.jasper.xmlparser.ParserUtils; -import org.apache.jasper.xmlparser.TreeNode; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * A container for all tag libraries that are defined "globally" - * for the web application. - * - * Tag Libraries can be defined globally in one of two ways: - * 1. Via elements in web.xml: - * the uri and location of the tag-library are specified in - * the element. - * 2. Via packaged jar files that contain .tld files - * within the META-INF directory, or some subdirectory - * of it. The taglib is 'global' if it has the - * element defined. - * - * A mapping between the taglib URI and its associated TaglibraryInfoImpl - * is maintained in this container. - * Actually, that's what we'd like to do. However, because of the - * way the classes TagLibraryInfo and TagInfo have been defined, - * it is not currently possible to share an instance of TagLibraryInfo - * across page invocations. A bug has been submitted to the spec lead. - * In the mean time, all we do is save the 'location' where the - * TLD associated with a taglib URI can be found. - * - * When a JSP page has a taglib directive, the mappings in this container - * are first searched (see method getLocation()). - * If a mapping is found, then the location of the TLD is returned. - * If no mapping is found, then the uri specified - * in the taglib directive is to be interpreted as the location for - * the TLD of this tag library. - * - * @author Pierre Delisle - * @author Jan Luehe - */ - -public class TldLocationsCache { - - // Logger - private Log log = LogFactory.getLog(TldLocationsCache.class); - - /** - * The types of URI one may specify for a tag library - */ - public static final int ABS_URI = 0; - public static final int ROOT_REL_URI = 1; - public static final int NOROOT_REL_URI = 2; - - private static final String WEB_XML = "/WEB-INF/web.xml"; - private static final String FILE_PROTOCOL = "file:"; - private static final String JAR_FILE_SUFFIX = ".jar"; - - // Names of JARs that are known not to contain any TLDs - private static HashSet noTldJars; - - /** - * The mapping of the 'global' tag library URI to the location (resource - * path) of the TLD associated with that tag library. The location is - * returned as a String array: - * [0] The location - * [1] If the location is a jar file, this is the location of the tld. - */ - private Hashtable mappings; - - private boolean initialized; - private ServletContext ctxt; - private boolean redeployMode; - - //********************************************************************* - // Constructor and Initilizations - - /* - * Initializes the set of JARs that are known not to contain any TLDs - */ - static { - noTldJars = new HashSet(); - // Bootstrap JARs - noTldJars.add("bootstrap.jar"); - noTldJars.add("commons-daemon.jar"); - noTldJars.add("tomcat-juli.jar"); - // Main JARs - noTldJars.add("annotations-api.jar"); - noTldJars.add("catalina.jar"); - noTldJars.add("catalina-ant.jar"); - noTldJars.add("catalina-ha.jar"); - noTldJars.add("catalina-tribes.jar"); - noTldJars.add("el-api.jar"); - noTldJars.add("jasper.jar"); - noTldJars.add("jasper-el.jar"); - noTldJars.add("jasper-jdt.jar"); - noTldJars.add("jsp-api.jar"); - noTldJars.add("servlet-api.jar"); - noTldJars.add("tomcat-coyote.jar"); - noTldJars.add("tomcat-dbcp.jar"); - // i18n JARs - noTldJars.add("tomcat-i18n-en.jar"); - noTldJars.add("tomcat-i18n-es.jar"); - noTldJars.add("tomcat-i18n-fr.jar"); - noTldJars.add("tomcat-i18n-ja.jar"); - // Misc JARs not included with Tomcat - noTldJars.add("ant.jar"); - noTldJars.add("commons-dbcp.jar"); - noTldJars.add("commons-beanutils.jar"); - noTldJars.add("commons-fileupload-1.0.jar"); - noTldJars.add("commons-pool.jar"); - noTldJars.add("commons-digester.jar"); - noTldJars.add("commons-logging.jar"); - noTldJars.add("commons-collections.jar"); - noTldJars.add("jmx.jar"); - noTldJars.add("jmx-tools.jar"); - noTldJars.add("xercesImpl.jar"); - noTldJars.add("xmlParserAPIs.jar"); - noTldJars.add("xml-apis.jar"); - // JARs from J2SE runtime - noTldJars.add("sunjce_provider.jar"); - noTldJars.add("ldapsec.jar"); - noTldJars.add("localedata.jar"); - noTldJars.add("dnsns.jar"); - noTldJars.add("tools.jar"); - noTldJars.add("sunpkcs11.jar"); - } - - public TldLocationsCache(ServletContext ctxt) { - this(ctxt, true); - } - - /** Constructor. - * - * @param ctxt the servlet context of the web application in which Jasper - * is running - * @param redeployMode if true, then the compiler will allow redeploying - * a tag library from the same jar, at the expense of slowing down the - * server a bit. Note that this may only work on JDK 1.3.1_01a and later, - * because of JDK bug 4211817 fixed in this release. - * If redeployMode is false, a faster but less capable mode will be used. - */ - public TldLocationsCache(ServletContext ctxt, boolean redeployMode) { - this.ctxt = ctxt; - this.redeployMode = redeployMode; - mappings = new Hashtable(); - initialized = false; - } - - /** - * Sets the list of JARs that are known not to contain any TLDs. - * - * @param jarNames List of comma-separated names of JAR files that are - * known not to contain any TLDs - */ - public static void setNoTldJars(String jarNames) { - if (jarNames != null) { - noTldJars.clear(); - StringTokenizer tokenizer = new StringTokenizer(jarNames, ","); - while (tokenizer.hasMoreElements()) { - noTldJars.add(tokenizer.nextToken()); - } - } - } - - /** - * Gets the 'location' of the TLD associated with the given taglib 'uri'. - * - * Returns null if the uri is not associated with any tag library 'exposed' - * in the web application. A tag library is 'exposed' either explicitly in - * web.xml or implicitly via the uri tag in the TLD of a taglib deployed - * in a jar file (WEB-INF/lib). - * - * @param uri The taglib uri - * - * @return An array of two Strings: The first element denotes the real - * path to the TLD. If the path to the TLD points to a jar file, then the - * second element denotes the name of the TLD entry in the jar file. - * Returns null if the uri is not associated with any tag library 'exposed' - * in the web application. - */ - public String[] getLocation(String uri) throws JasperException { - if (!initialized) { - init(); - } - return (String[]) mappings.get(uri); - } - - /** - * Returns the type of a URI: - * ABS_URI - * ROOT_REL_URI - * NOROOT_REL_URI - */ - public static int uriType(String uri) { - if (uri.indexOf(':') != -1) { - return ABS_URI; - } else if (uri.startsWith("/")) { - return ROOT_REL_URI; - } else { - return NOROOT_REL_URI; - } - } - - private void init() throws JasperException { - if (initialized) return; - try { - processWebDotXml(); - scanJars(); - processTldsInFileSystem("/WEB-INF/"); - initialized = true; - } catch (Exception ex) { - throw new JasperException(Localizer.getMessage( - "jsp.error.internal.tldinit", ex.getMessage())); - } - } - - /* - * Populates taglib map described in web.xml. - */ - private void processWebDotXml() throws Exception { - - InputStream is = null; - - try { - // Acquire input stream to web application deployment descriptor - String altDDName = (String)ctxt.getAttribute( - Constants.ALT_DD_ATTR); - URL uri = null; - if (altDDName != null) { - try { - uri = new URL(FILE_PROTOCOL+altDDName.replace('\\', '/')); - } catch (MalformedURLException e) { - if (log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.error.internal.filenotfound", - altDDName)); - } - } - } else { - uri = ctxt.getResource(WEB_XML); - if (uri == null && log.isWarnEnabled()) { - log.warn(Localizer.getMessage( - "jsp.error.internal.filenotfound", - WEB_XML)); - } - } - - if (uri == null) { - return; - } - is = uri.openStream(); - InputSource ip = new InputSource(is); - ip.setSystemId(uri.toExternalForm()); - - // Parse the web application deployment descriptor - TreeNode webtld = null; - // altDDName is the absolute path of the DD - if (altDDName != null) { - webtld = new ParserUtils().parseXMLDocument(altDDName, ip); - } else { - webtld = new ParserUtils().parseXMLDocument(WEB_XML, ip); - } - - // Allow taglib to be an element of the root or jsp-config (JSP2.0) - TreeNode jspConfig = webtld.findChild("jsp-config"); - if (jspConfig != null) { - webtld = jspConfig; - } - Iterator taglibs = webtld.findChildren("taglib"); - while (taglibs.hasNext()) { - - // Parse the next element - TreeNode taglib = (TreeNode) taglibs.next(); - String tagUri = null; - String tagLoc = null; - TreeNode child = taglib.findChild("taglib-uri"); - if (child != null) - tagUri = child.getBody(); - child = taglib.findChild("taglib-location"); - if (child != null) - tagLoc = child.getBody(); - - // Save this location if appropriate - if (tagLoc == null) - continue; - if (uriType(tagLoc) == NOROOT_REL_URI) - tagLoc = "/WEB-INF/" + tagLoc; - String tagLoc2 = null; - if (tagLoc.endsWith(JAR_FILE_SUFFIX)) { - tagLoc = ctxt.getResource(tagLoc).toString(); - tagLoc2 = "META-INF/taglib.tld"; - } - mappings.put(tagUri, new String[] { tagLoc, tagLoc2 }); - } - } finally { - if (is != null) { - try { - is.close(); - } catch (Throwable t) {} - } - } - } - - /** - * Scans the given JarURLConnection for TLD files located in META-INF - * (or a subdirectory of it), adding an implicit map entry to the taglib - * map for any TLD that has a element. - * - * @param conn The JarURLConnection to the JAR file to scan - * @param ignore true if any exceptions raised when processing the given - * JAR should be ignored, false otherwise - */ - private void scanJar(JarURLConnection conn, boolean ignore) - throws JasperException { - - JarFile jarFile = null; - String resourcePath = conn.getJarFileURL().toString(); - try { - if (redeployMode) { - conn.setUseCaches(false); - } - jarFile = conn.getJarFile(); - Enumeration entries = jarFile.entries(); - while (entries.hasMoreElements()) { - JarEntry entry = (JarEntry) entries.nextElement(); - String name = entry.getName(); - if (!name.startsWith("META-INF/")) continue; - if (!name.endsWith(".tld")) continue; - InputStream stream = jarFile.getInputStream(entry); - try { - String uri = getUriFromTld(resourcePath, stream); - // Add implicit map entry only if its uri is not already - // present in the map - if (uri != null && mappings.get(uri) == null) { - mappings.put(uri, new String[]{ resourcePath, name }); - } - } finally { - if (stream != null) { - try { - stream.close(); - } catch (Throwable t) { - // do nothing - } - } - } - } - } catch (Exception ex) { - if (!redeployMode) { - // if not in redeploy mode, close the jar in case of an error - if (jarFile != null) { - try { - jarFile.close(); - } catch (Throwable t) { - // ignore - } - } - } - if (!ignore) { - throw new JasperException(ex); - } - } finally { - if (redeployMode) { - // if in redeploy mode, always close the jar - if (jarFile != null) { - try { - jarFile.close(); - } catch (Throwable t) { - // ignore - } - } - } - } - } - - /* - * Searches the filesystem under /WEB-INF for any TLD files, and adds - * an implicit map entry to the taglib map for any TLD that has a - * element. - */ - private void processTldsInFileSystem(String startPath) - throws Exception { - - Set dirList = ctxt.getResourcePaths(startPath); - if (dirList != null) { - Iterator it = dirList.iterator(); - while (it.hasNext()) { - String path = (String) it.next(); - if (path.endsWith("/")) { - processTldsInFileSystem(path); - } - if (!path.endsWith(".tld")) { - continue; - } - InputStream stream = ctxt.getResourceAsStream(path); - String uri = null; - try { - uri = getUriFromTld(path, stream); - } finally { - if (stream != null) { - try { - stream.close(); - } catch (Throwable t) { - // do nothing - } - } - } - // Add implicit map entry only if its uri is not already - // present in the map - if (uri != null && mappings.get(uri) == null) { - mappings.put(uri, new String[] { path, null }); - } - } - } - } - - /* - * Returns the value of the uri element of the given TLD, or null if the - * given TLD does not contain any such element. - */ - private String getUriFromTld(String resourcePath, InputStream in) - throws JasperException - { - // Parse the tag library descriptor at the specified resource path - TreeNode tld = new ParserUtils().parseXMLDocument(resourcePath, in); - TreeNode uri = tld.findChild("uri"); - if (uri != null) { - String body = uri.getBody(); - if (body != null) - return body; - } - - return null; - } - - /* - * Scans all JARs accessible to the webapp's classloader and its - * parent classloaders for TLDs. - * - * The list of JARs always includes the JARs under WEB-INF/lib, as well as - * all shared JARs in the classloader delegation chain of the webapp's - * classloader. - * - * Considering JARs in the classloader delegation chain constitutes a - * Tomcat-specific extension to the TLD search - * order defined in the JSP spec. It allows tag libraries packaged as JAR - * files to be shared by web applications by simply dropping them in a - * location that all web applications have access to (e.g., - * /common/lib). - * - * The set of shared JARs to be scanned for TLDs is narrowed down by - * the noTldJars class variable, which contains the names of JARs - * that are known not to contain any TLDs. - */ - private void scanJars() throws Exception { - - ClassLoader webappLoader - = Thread.currentThread().getContextClassLoader(); - ClassLoader loader = webappLoader; - - while (loader != null) { - if (loader instanceof URLClassLoader) { - URL[] urls = ((URLClassLoader) loader).getURLs(); - for (int i=0; ijarPath needs to be - * scanned for TLDs. - * - * @param loader The current classloader in the parent chain - * @param webappLoader The webapp classloader - * @param jarPath The JAR file path - * - * @return TRUE if the JAR file identified by jarPath needs to be - * scanned for TLDs, FALSE otherwise - */ - private boolean needScanJar(ClassLoader loader, ClassLoader webappLoader, - String jarPath) { - if (loader == webappLoader) { - // JARs under WEB-INF/lib must be scanned unconditionally according - // to the spec. - return true; - } else { - String jarName = jarPath; - int slash = jarPath.lastIndexOf('/'); - if (slash >= 0) { - jarName = jarPath.substring(slash + 1); - } - return (!noTldJars.contains(jarName)); - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Validator.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Validator.java deleted file mode 100644 index dd73aee73..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/Validator.java +++ /dev/null @@ -1,1799 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler; - -import java.lang.reflect.Method; -import java.util.ArrayList; -import java.util.HashMap; -import java.util.Hashtable; -import java.util.Iterator; - -import javax.el.ELException; -import javax.el.ExpressionFactory; -import javax.el.FunctionMapper; -import javax.servlet.jsp.tagext.FunctionInfo; -import javax.servlet.jsp.tagext.JspFragment; -import javax.servlet.jsp.tagext.PageData; -import javax.servlet.jsp.tagext.TagAttributeInfo; -import javax.servlet.jsp.tagext.TagData; -import javax.servlet.jsp.tagext.TagExtraInfo; -import javax.servlet.jsp.tagext.TagInfo; -import javax.servlet.jsp.tagext.TagLibraryInfo; -import javax.servlet.jsp.tagext.ValidationMessage; - -import org.apache.el.lang.ELSupport; -import org.apache.jasper.Constants; -import org.apache.jasper.JasperException; -import org.apache.jasper.el.ELContextImpl; -import org.xml.sax.Attributes; - -/** - * Performs validation on the page elements. Attributes are checked for - * mandatory presence, entry value validity, and consistency. As a side effect, - * some page global value (such as those from page direcitves) are stored, for - * later use. - * - * @author Kin-man Chung - * @author Jan Luehe - * @author Shawn Bayern - * @author Mark Roth - */ -class Validator { - - /** - * A visitor to validate and extract page directive info - */ - static class DirectiveVisitor extends Node.Visitor { - - private PageInfo pageInfo; - - private ErrorDispatcher err; - - private static final JspUtil.ValidAttribute[] pageDirectiveAttrs = { - new JspUtil.ValidAttribute("language"), - new JspUtil.ValidAttribute("extends"), - new JspUtil.ValidAttribute("import"), - new JspUtil.ValidAttribute("session"), - new JspUtil.ValidAttribute("buffer"), - new JspUtil.ValidAttribute("autoFlush"), - new JspUtil.ValidAttribute("isThreadSafe"), - new JspUtil.ValidAttribute("info"), - new JspUtil.ValidAttribute("errorPage"), - new JspUtil.ValidAttribute("isErrorPage"), - new JspUtil.ValidAttribute("contentType"), - new JspUtil.ValidAttribute("pageEncoding"), - new JspUtil.ValidAttribute("isELIgnored"), - new JspUtil.ValidAttribute("deferredSyntaxAllowedAsLiteral"), - new JspUtil.ValidAttribute("trimDirectiveWhitespaces") - }; - - private boolean pageEncodingSeen = false; - - /* - * Constructor - */ - DirectiveVisitor(Compiler compiler) throws JasperException { - this.pageInfo = compiler.getPageInfo(); - this.err = compiler.getErrorDispatcher(); - } - - public void visit(Node.IncludeDirective n) throws JasperException { - // Since pageDirectiveSeen flag only applies to the Current page - // save it here and restore it after the file is included. - boolean pageEncodingSeenSave = pageEncodingSeen; - pageEncodingSeen = false; - visitBody(n); - pageEncodingSeen = pageEncodingSeenSave; - } - - public void visit(Node.PageDirective n) throws JasperException { - - JspUtil.checkAttributes("Page directive", n, pageDirectiveAttrs, - err); - - // JSP.2.10.1 - Attributes attrs = n.getAttributes(); - for (int i = 0; attrs != null && i < attrs.getLength(); i++) { - String attr = attrs.getQName(i); - String value = attrs.getValue(i); - - if ("language".equals(attr)) { - if (pageInfo.getLanguage(false) == null) { - pageInfo.setLanguage(value, n, err, true); - } else if (!pageInfo.getLanguage(false).equals(value)) { - err.jspError(n, "jsp.error.page.conflict.language", - pageInfo.getLanguage(false), value); - } - } else if ("extends".equals(attr)) { - if (pageInfo.getExtends(false) == null) { - pageInfo.setExtends(value, n); - } else if (!pageInfo.getExtends(false).equals(value)) { - err.jspError(n, "jsp.error.page.conflict.extends", - pageInfo.getExtends(false), value); - } - } else if ("contentType".equals(attr)) { - if (pageInfo.getContentType() == null) { - pageInfo.setContentType(value); - } else if (!pageInfo.getContentType().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.contenttype", - pageInfo.getContentType(), value); - } - } else if ("session".equals(attr)) { - if (pageInfo.getSession() == null) { - pageInfo.setSession(value, n, err); - } else if (!pageInfo.getSession().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.session", - pageInfo.getSession(), value); - } - } else if ("buffer".equals(attr)) { - if (pageInfo.getBufferValue() == null) { - pageInfo.setBufferValue(value, n, err); - } else if (!pageInfo.getBufferValue().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.buffer", - pageInfo.getBufferValue(), value); - } - } else if ("autoFlush".equals(attr)) { - if (pageInfo.getAutoFlush() == null) { - pageInfo.setAutoFlush(value, n, err); - } else if (!pageInfo.getAutoFlush().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.autoflush", - pageInfo.getAutoFlush(), value); - } - } else if ("isThreadSafe".equals(attr)) { - if (pageInfo.getIsThreadSafe() == null) { - pageInfo.setIsThreadSafe(value, n, err); - } else if (!pageInfo.getIsThreadSafe().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.isthreadsafe", - pageInfo.getIsThreadSafe(), value); - } - } else if ("isELIgnored".equals(attr)) { - if (pageInfo.getIsELIgnored() == null) { - pageInfo.setIsELIgnored(value, n, err, true); - } else if (!pageInfo.getIsELIgnored().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.iselignored", - pageInfo.getIsELIgnored(), value); - } - } else if ("isErrorPage".equals(attr)) { - if (pageInfo.getIsErrorPage() == null) { - pageInfo.setIsErrorPage(value, n, err); - } else if (!pageInfo.getIsErrorPage().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.iserrorpage", - pageInfo.getIsErrorPage(), value); - } - } else if ("errorPage".equals(attr)) { - if (pageInfo.getErrorPage() == null) { - pageInfo.setErrorPage(value); - } else if (!pageInfo.getErrorPage().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.errorpage", - pageInfo.getErrorPage(), value); - } - } else if ("info".equals(attr)) { - if (pageInfo.getInfo() == null) { - pageInfo.setInfo(value); - } else if (!pageInfo.getInfo().equals(value)) { - err.jspError(n, "jsp.error.page.conflict.info", - pageInfo.getInfo(), value); - } - } else if ("pageEncoding".equals(attr)) { - if (pageEncodingSeen) - err.jspError(n, "jsp.error.page.multi.pageencoding"); - // 'pageEncoding' can occur at most once per file - pageEncodingSeen = true; - String actual = comparePageEncodings(value, n); - n.getRoot().setPageEncoding(actual); - } else if ("deferredSyntaxAllowedAsLiteral".equals(attr)) { - if (pageInfo.getDeferredSyntaxAllowedAsLiteral() == null) { - pageInfo.setDeferredSyntaxAllowedAsLiteral(value, n, - err, true); - } else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral() - .equals(value)) { - err - .jspError( - n, - "jsp.error.page.conflict.deferredsyntaxallowedasliteral", - pageInfo - .getDeferredSyntaxAllowedAsLiteral(), - value); - } - } else if ("trimDirectiveWhitespaces".equals(attr)) { - if (pageInfo.getTrimDirectiveWhitespaces() == null) { - pageInfo.setTrimDirectiveWhitespaces(value, n, err, - true); - } else if (!pageInfo.getTrimDirectiveWhitespaces().equals( - value)) { - err - .jspError( - n, - "jsp.error.page.conflict.trimdirectivewhitespaces", - pageInfo.getTrimDirectiveWhitespaces(), - value); - } - } - } - - // Check for bad combinations - if (pageInfo.getBuffer() == 0 && !pageInfo.isAutoFlush()) - err.jspError(n, "jsp.error.page.badCombo"); - - // Attributes for imports for this node have been processed by - // the parsers, just add them to pageInfo. - pageInfo.addImports(n.getImports()); - } - - public void visit(Node.TagDirective n) throws JasperException { - // Note: Most of the validation is done in TagFileProcessor - // when it created a TagInfo object from the - // tag file in which the directive appeared. - - // This method does additional processing to collect page info - - Attributes attrs = n.getAttributes(); - for (int i = 0; attrs != null && i < attrs.getLength(); i++) { - String attr = attrs.getQName(i); - String value = attrs.getValue(i); - - if ("language".equals(attr)) { - if (pageInfo.getLanguage(false) == null) { - pageInfo.setLanguage(value, n, err, false); - } else if (!pageInfo.getLanguage(false).equals(value)) { - err.jspError(n, "jsp.error.tag.conflict.language", - pageInfo.getLanguage(false), value); - } - } else if ("isELIgnored".equals(attr)) { - if (pageInfo.getIsELIgnored() == null) { - pageInfo.setIsELIgnored(value, n, err, false); - } else if (!pageInfo.getIsELIgnored().equals(value)) { - err.jspError(n, "jsp.error.tag.conflict.iselignored", - pageInfo.getIsELIgnored(), value); - } - } else if ("pageEncoding".equals(attr)) { - if (pageEncodingSeen) - err.jspError(n, "jsp.error.tag.multi.pageencoding"); - pageEncodingSeen = true; - compareTagEncodings(value, n); - n.getRoot().setPageEncoding(value); - } else if ("deferredSyntaxAllowedAsLiteral".equals(attr)) { - if (pageInfo.getDeferredSyntaxAllowedAsLiteral() == null) { - pageInfo.setDeferredSyntaxAllowedAsLiteral(value, n, - err, false); - } else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral() - .equals(value)) { - err - .jspError( - n, - "jsp.error.tag.conflict.deferredsyntaxallowedasliteral", - pageInfo - .getDeferredSyntaxAllowedAsLiteral(), - value); - } - } else if ("trimDirectiveWhitespaces".equals(attr)) { - if (pageInfo.getTrimDirectiveWhitespaces() == null) { - pageInfo.setTrimDirectiveWhitespaces(value, n, err, - false); - } else if (!pageInfo.getTrimDirectiveWhitespaces().equals( - value)) { - err - .jspError( - n, - "jsp.error.tag.conflict.trimdirectivewhitespaces", - pageInfo.getTrimDirectiveWhitespaces(), - value); - } - } - } - - // Attributes for imports for this node have been processed by - // the parsers, just add them to pageInfo. - pageInfo.addImports(n.getImports()); - } - - public void visit(Node.AttributeDirective n) throws JasperException { - // Do nothing, since this attribute directive has already been - // validated by TagFileProcessor when it created a TagInfo object - // from the tag file in which the directive appeared - } - - public void visit(Node.VariableDirective n) throws JasperException { - // Do nothing, since this variable directive has already been - // validated by TagFileProcessor when it created a TagInfo object - // from the tag file in which the directive appeared - } - - /* - * Compares page encodings specified in various places, and throws - * exception in case of page encoding mismatch. - * - * @param pageDirEnc The value of the pageEncoding attribute of the page - * directive @param pageDir The page directive node - * - * @throws JasperException in case of page encoding mismatch - */ - private String comparePageEncodings(String thePageDirEnc, - Node.PageDirective pageDir) throws JasperException { - - Node.Root root = pageDir.getRoot(); - String configEnc = root.getJspConfigPageEncoding(); - String pageDirEnc = thePageDirEnc.toUpperCase(); - - /* - * Compare the 'pageEncoding' attribute of the page directive with - * the encoding specified in the JSP config element whose URL - * pattern matches this page. Treat "UTF-16", "UTF-16BE", and - * "UTF-16LE" as identical. - */ - if (configEnc != null) { - configEnc = configEnc.toUpperCase(); - if (!pageDirEnc.equals(configEnc) - && (!pageDirEnc.startsWith("UTF-16") || !configEnc - .startsWith("UTF-16"))) { - err.jspError(pageDir, - "jsp.error.config_pagedir_encoding_mismatch", - configEnc, pageDirEnc); - } else { - return configEnc; - } - } - - /* - * Compare the 'pageEncoding' attribute of the page directive with - * the encoding specified in the XML prolog (only for XML syntax, - * and only if JSP document contains XML prolog with encoding - * declaration). Treat "UTF-16", "UTF-16BE", and "UTF-16LE" as - * identical. - */ - if ((root.isXmlSyntax() && root.isEncodingSpecifiedInProlog()) || root.isBomPresent()) { - String pageEnc = root.getPageEncoding().toUpperCase(); - if (!pageDirEnc.equals(pageEnc) - && (!pageDirEnc.startsWith("UTF-16") || !pageEnc - .startsWith("UTF-16"))) { - err.jspError(pageDir, - "jsp.error.prolog_pagedir_encoding_mismatch", - pageEnc, pageDirEnc); - } else { - return pageEnc; - } - } - - return pageDirEnc; - } - - /* - * Compares page encodings specified in various places, and throws - * exception in case of page encoding mismatch. - * - * @param thePageDirEnc The value of the pageEncoding attribute of the page - * directive @param pageDir The page directive node - * - * @throws JasperException in case of page encoding mismatch - */ - private void compareTagEncodings(String thePageDirEnc, - Node.TagDirective pageDir) throws JasperException { - - Node.Root root = pageDir.getRoot(); - String pageDirEnc = thePageDirEnc.toUpperCase(); - /* - * Compare the 'pageEncoding' attribute of the page directive with - * the encoding specified in the XML prolog (only for XML syntax, - * and only if JSP document contains XML prolog with encoding - * declaration). Treat "UTF-16", "UTF-16BE", and "UTF-16LE" as - * identical. - */ - if ((root.isXmlSyntax() && root.isEncodingSpecifiedInProlog()) || root.isBomPresent()) { - String pageEnc = root.getPageEncoding().toUpperCase(); - if (!pageDirEnc.equals(pageEnc) - && (!pageDirEnc.startsWith("UTF-16") || !pageEnc - .startsWith("UTF-16"))) { - err.jspError(pageDir, - "jsp.error.prolog_pagedir_encoding_mismatch", - pageEnc, pageDirEnc); - } - } - } - - } - - /** - * A visitor for validating nodes other than page directives - */ - static class ValidateVisitor extends Node.Visitor { - - private PageInfo pageInfo; - - private ErrorDispatcher err; - - private TagInfo tagInfo; - - private ClassLoader loader; - - private final StringBuffer buf = new StringBuffer(32); - - private static final JspUtil.ValidAttribute[] jspRootAttrs = { - new JspUtil.ValidAttribute("xsi:schemaLocation"), - new JspUtil.ValidAttribute("version", true) }; - - private static final JspUtil.ValidAttribute[] includeDirectiveAttrs = { new JspUtil.ValidAttribute( - "file", true) }; - - private static final JspUtil.ValidAttribute[] taglibDirectiveAttrs = { - new JspUtil.ValidAttribute("uri"), - new JspUtil.ValidAttribute("tagdir"), - new JspUtil.ValidAttribute("prefix", true) }; - - private static final JspUtil.ValidAttribute[] includeActionAttrs = { - new JspUtil.ValidAttribute("page", true, true), - new JspUtil.ValidAttribute("flush") }; - - private static final JspUtil.ValidAttribute[] paramActionAttrs = { - new JspUtil.ValidAttribute("name", true), - new JspUtil.ValidAttribute("value", true, true) }; - - private static final JspUtil.ValidAttribute[] forwardActionAttrs = { new JspUtil.ValidAttribute( - "page", true, true) }; - - private static final JspUtil.ValidAttribute[] getPropertyAttrs = { - new JspUtil.ValidAttribute("name", true), - new JspUtil.ValidAttribute("property", true) }; - - private static final JspUtil.ValidAttribute[] setPropertyAttrs = { - new JspUtil.ValidAttribute("name", true), - new JspUtil.ValidAttribute("property", true), - new JspUtil.ValidAttribute("value", false, true), - new JspUtil.ValidAttribute("param") }; - - private static final JspUtil.ValidAttribute[] useBeanAttrs = { - new JspUtil.ValidAttribute("id", true), - new JspUtil.ValidAttribute("scope"), - new JspUtil.ValidAttribute("class"), - new JspUtil.ValidAttribute("type"), - new JspUtil.ValidAttribute("beanName", false, true) }; - - private static final JspUtil.ValidAttribute[] plugInAttrs = { - new JspUtil.ValidAttribute("type", true), - new JspUtil.ValidAttribute("code", true), - new JspUtil.ValidAttribute("codebase"), - new JspUtil.ValidAttribute("align"), - new JspUtil.ValidAttribute("archive"), - new JspUtil.ValidAttribute("height", false, true), - new JspUtil.ValidAttribute("hspace"), - new JspUtil.ValidAttribute("jreversion"), - new JspUtil.ValidAttribute("name"), - new JspUtil.ValidAttribute("vspace"), - new JspUtil.ValidAttribute("width", false, true), - new JspUtil.ValidAttribute("nspluginurl"), - new JspUtil.ValidAttribute("iepluginurl") }; - - private static final JspUtil.ValidAttribute[] attributeAttrs = { - new JspUtil.ValidAttribute("name", true), - new JspUtil.ValidAttribute("trim") }; - - private static final JspUtil.ValidAttribute[] invokeAttrs = { - new JspUtil.ValidAttribute("fragment", true), - new JspUtil.ValidAttribute("var"), - new JspUtil.ValidAttribute("varReader"), - new JspUtil.ValidAttribute("scope") }; - - private static final JspUtil.ValidAttribute[] doBodyAttrs = { - new JspUtil.ValidAttribute("var"), - new JspUtil.ValidAttribute("varReader"), - new JspUtil.ValidAttribute("scope") }; - - private static final JspUtil.ValidAttribute[] jspOutputAttrs = { - new JspUtil.ValidAttribute("omit-xml-declaration"), - new JspUtil.ValidAttribute("doctype-root-element"), - new JspUtil.ValidAttribute("doctype-public"), - new JspUtil.ValidAttribute("doctype-system") }; - - /* - * Constructor - */ - ValidateVisitor(Compiler compiler) { - this.pageInfo = compiler.getPageInfo(); - this.err = compiler.getErrorDispatcher(); - this.tagInfo = compiler.getCompilationContext().getTagInfo(); - this.loader = compiler.getCompilationContext().getClassLoader(); - } - - public void visit(Node.JspRoot n) throws JasperException { - JspUtil.checkAttributes("Jsp:root", n, jspRootAttrs, err); - String version = n.getTextAttribute("version"); - if (!version.equals("1.2") && !version.equals("2.0") && !version.equals("2.1")) { - err.jspError(n, "jsp.error.jsproot.version.invalid", version); - } - visitBody(n); - } - - public void visit(Node.IncludeDirective n) throws JasperException { - JspUtil.checkAttributes("Include directive", n, - includeDirectiveAttrs, err); - visitBody(n); - } - - public void visit(Node.TaglibDirective n) throws JasperException { - JspUtil.checkAttributes("Taglib directive", n, - taglibDirectiveAttrs, err); - // Either 'uri' or 'tagdir' attribute must be specified - String uri = n.getAttributeValue("uri"); - String tagdir = n.getAttributeValue("tagdir"); - if (uri == null && tagdir == null) { - err.jspError(n, "jsp.error.taglibDirective.missing.location"); - } - if (uri != null && tagdir != null) { - err - .jspError(n, - "jsp.error.taglibDirective.both_uri_and_tagdir"); - } - } - - public void visit(Node.ParamAction n) throws JasperException { - JspUtil.checkAttributes("Param action", n, paramActionAttrs, err); - // make sure the value of the 'name' attribute is not a - // request-time expression - throwErrorIfExpression(n, "name", "jsp:param"); - n.setValue(getJspAttribute(null, "value", null, null, n - .getAttributeValue("value"), java.lang.String.class, n, - false)); - visitBody(n); - } - - public void visit(Node.ParamsAction n) throws JasperException { - // Make sure we've got at least one nested jsp:param - Node.Nodes subElems = n.getBody(); - if (subElems == null) { - err.jspError(n, "jsp.error.params.emptyBody"); - } - visitBody(n); - } - - public void visit(Node.IncludeAction n) throws JasperException { - JspUtil.checkAttributes("Include action", n, includeActionAttrs, - err); - n.setPage(getJspAttribute(null, "page", null, null, n - .getAttributeValue("page"), java.lang.String.class, n, - false)); - visitBody(n); - }; - - public void visit(Node.ForwardAction n) throws JasperException { - JspUtil.checkAttributes("Forward", n, forwardActionAttrs, err); - n.setPage(getJspAttribute(null, "page", null, null, n - .getAttributeValue("page"), java.lang.String.class, n, - false)); - visitBody(n); - } - - public void visit(Node.GetProperty n) throws JasperException { - JspUtil.checkAttributes("GetProperty", n, getPropertyAttrs, err); - } - - public void visit(Node.SetProperty n) throws JasperException { - JspUtil.checkAttributes("SetProperty", n, setPropertyAttrs, err); - String property = n.getTextAttribute("property"); - String param = n.getTextAttribute("param"); - String value = n.getAttributeValue("value"); - - n.setValue(getJspAttribute(null, "value", null, null, value, - java.lang.Object.class, n, false)); - - boolean valueSpecified = n.getValue() != null; - - if ("*".equals(property)) { - if (param != null || valueSpecified) - err.jspError(n, "jsp.error.setProperty.invalid"); - - } else if (param != null && valueSpecified) { - err.jspError(n, "jsp.error.setProperty.invalid"); - } - - visitBody(n); - } - - public void visit(Node.UseBean n) throws JasperException { - JspUtil.checkAttributes("UseBean", n, useBeanAttrs, err); - - String name = n.getTextAttribute("id"); - String scope = n.getTextAttribute("scope"); - JspUtil.checkScope(scope, n, err); - String className = n.getTextAttribute("class"); - String type = n.getTextAttribute("type"); - BeanRepository beanInfo = pageInfo.getBeanRepository(); - - if (className == null && type == null) - err.jspError(n, "jsp.error.usebean.missingType"); - - if (beanInfo.checkVariable(name)) - err.jspError(n, "jsp.error.usebean.duplicate"); - - if ("session".equals(scope) && !pageInfo.isSession()) - err.jspError(n, "jsp.error.usebean.noSession"); - - Node.JspAttribute jattr = getJspAttribute(null, "beanName", null, - null, n.getAttributeValue("beanName"), - java.lang.String.class, n, false); - n.setBeanName(jattr); - if (className != null && jattr != null) - err.jspError(n, "jsp.error.usebean.notBoth"); - - if (className == null) - className = type; - - beanInfo.addBean(n, name, className, scope); - - visitBody(n); - } - - public void visit(Node.PlugIn n) throws JasperException { - JspUtil.checkAttributes("Plugin", n, plugInAttrs, err); - - throwErrorIfExpression(n, "type", "jsp:plugin"); - throwErrorIfExpression(n, "code", "jsp:plugin"); - throwErrorIfExpression(n, "codebase", "jsp:plugin"); - throwErrorIfExpression(n, "align", "jsp:plugin"); - throwErrorIfExpression(n, "archive", "jsp:plugin"); - throwErrorIfExpression(n, "hspace", "jsp:plugin"); - throwErrorIfExpression(n, "jreversion", "jsp:plugin"); - throwErrorIfExpression(n, "name", "jsp:plugin"); - throwErrorIfExpression(n, "vspace", "jsp:plugin"); - throwErrorIfExpression(n, "nspluginurl", "jsp:plugin"); - throwErrorIfExpression(n, "iepluginurl", "jsp:plugin"); - - String type = n.getTextAttribute("type"); - if (type == null) - err.jspError(n, "jsp.error.plugin.notype"); - if (!type.equals("bean") && !type.equals("applet")) - err.jspError(n, "jsp.error.plugin.badtype"); - if (n.getTextAttribute("code") == null) - err.jspError(n, "jsp.error.plugin.nocode"); - - Node.JspAttribute width = getJspAttribute(null, "width", null, - null, n.getAttributeValue("width"), java.lang.String.class, - n, false); - n.setWidth(width); - - Node.JspAttribute height = getJspAttribute(null, "height", null, - null, n.getAttributeValue("height"), - java.lang.String.class, n, false); - n.setHeight(height); - - visitBody(n); - } - - public void visit(Node.NamedAttribute n) throws JasperException { - JspUtil.checkAttributes("Attribute", n, attributeAttrs, err); - visitBody(n); - } - - public void visit(Node.JspBody n) throws JasperException { - visitBody(n); - } - - public void visit(Node.Declaration n) throws JasperException { - if (pageInfo.isScriptingInvalid()) { - err.jspError(n.getStart(), "jsp.error.no.scriptlets"); - } - } - - public void visit(Node.Expression n) throws JasperException { - if (pageInfo.isScriptingInvalid()) { - err.jspError(n.getStart(), "jsp.error.no.scriptlets"); - } - } - - public void visit(Node.Scriptlet n) throws JasperException { - if (pageInfo.isScriptingInvalid()) { - err.jspError(n.getStart(), "jsp.error.no.scriptlets"); - } - } - - public void visit(Node.ELExpression n) throws JasperException { - // exit if we are ignoring EL all together - if (pageInfo.isELIgnored()) - return; - - // JSP.2.2 - '#{' not allowed in template text - if (n.getType() == '#') { - if (!pageInfo.isDeferredSyntaxAllowedAsLiteral() - && (tagInfo == null - || ((tagInfo != null) && !(tagInfo.getTagLibrary().getRequiredVersion().equals("2.0") - || tagInfo.getTagLibrary().getRequiredVersion().equals("1.2"))))) { - err.jspError(n, "jsp.error.el.template.deferred"); - } else { - return; - } - } - - // build expression - StringBuffer expr = this.getBuffer(); - expr.append(n.getType()).append('{').append(n.getText()) - .append('}'); - ELNode.Nodes el = ELParser.parse(expr.toString()); - - // validate/prepare expression - prepareExpression(el, n, expr.toString()); - - // store it - n.setEL(el); - } - - public void visit(Node.UninterpretedTag n) throws JasperException { - if (n.getNamedAttributeNodes().size() != 0) { - err.jspError(n, "jsp.error.namedAttribute.invalidUse"); - } - - Attributes attrs = n.getAttributes(); - if (attrs != null) { - int attrSize = attrs.getLength(); - Node.JspAttribute[] jspAttrs = new Node.JspAttribute[attrSize]; - for (int i = 0; i < attrSize; i++) { - jspAttrs[i] = getJspAttribute(null, attrs.getQName(i), - attrs.getURI(i), attrs.getLocalName(i), attrs - .getValue(i), java.lang.Object.class, n, - false); - } - n.setJspAttributes(jspAttrs); - } - - visitBody(n); - } - - public void visit(Node.CustomTag n) throws JasperException { - - TagInfo tagInfo = n.getTagInfo(); - if (tagInfo == null) { - err.jspError(n, "jsp.error.missing.tagInfo", n.getQName()); - } - - /* - * The bodyconet of a SimpleTag cannot be JSP. - */ - if (n.implementsSimpleTag() - && tagInfo.getBodyContent().equalsIgnoreCase( - TagInfo.BODY_CONTENT_JSP)) { - err.jspError(n, "jsp.error.simpletag.badbodycontent", tagInfo - .getTagClassName()); - } - - /* - * If the tag handler declares in the TLD that it supports dynamic - * attributes, it also must implement the DynamicAttributes - * interface. - */ - if (tagInfo.hasDynamicAttributes() - && !n.implementsDynamicAttributes()) { - err.jspError(n, "jsp.error.dynamic.attributes.not.implemented", - n.getQName()); - } - - /* - * Make sure all required attributes are present, either as - * attributes or named attributes (). Also make sure - * that the same attribute is not specified in both attributes or - * named attributes. - */ - TagAttributeInfo[] tldAttrs = tagInfo.getAttributes(); - String customActionUri = n.getURI(); - Attributes attrs = n.getAttributes(); - int attrsSize = (attrs == null) ? 0 : attrs.getLength(); - for (int i = 0; i < tldAttrs.length; i++) { - String attr = null; - if (attrs != null) { - attr = attrs.getValue(tldAttrs[i].getName()); - if (attr == null) { - attr = attrs.getValue(customActionUri, tldAttrs[i] - .getName()); - } - } - Node.NamedAttribute na = n.getNamedAttributeNode(tldAttrs[i] - .getName()); - - if (tldAttrs[i].isRequired() && attr == null && na == null) { - err.jspError(n, "jsp.error.missing_attribute", tldAttrs[i] - .getName(), n.getLocalName()); - } - if (attr != null && na != null) { - err.jspError(n, "jsp.error.duplicate.name.jspattribute", - tldAttrs[i].getName()); - } - } - - Node.Nodes naNodes = n.getNamedAttributeNodes(); - int jspAttrsSize = naNodes.size() + attrsSize; - Node.JspAttribute[] jspAttrs = null; - if (jspAttrsSize > 0) { - jspAttrs = new Node.JspAttribute[jspAttrsSize]; - } - Hashtable tagDataAttrs = new Hashtable(attrsSize); - - checkXmlAttributes(n, jspAttrs, tagDataAttrs); - checkNamedAttributes(n, jspAttrs, attrsSize, tagDataAttrs); - - TagData tagData = new TagData(tagDataAttrs); - - // JSP.C1: It is a (translation time) error for an action that - // has one or more variable subelements to have a TagExtraInfo - // class that returns a non-null object. - TagExtraInfo tei = tagInfo.getTagExtraInfo(); - if (tei != null && tei.getVariableInfo(tagData) != null - && tei.getVariableInfo(tagData).length > 0 - && tagInfo.getTagVariableInfos().length > 0) { - err.jspError("jsp.error.non_null_tei_and_var_subelems", n - .getQName()); - } - - n.setTagData(tagData); - n.setJspAttributes(jspAttrs); - - visitBody(n); - } - - public void visit(Node.JspElement n) throws JasperException { - - Attributes attrs = n.getAttributes(); - if (attrs == null) { - err.jspError(n, "jsp.error.jspelement.missing.name"); - } - int xmlAttrLen = attrs.getLength(); - - Node.Nodes namedAttrs = n.getNamedAttributeNodes(); - - // XML-style 'name' attribute, which is mandatory, must not be - // included in JspAttribute array - int jspAttrSize = xmlAttrLen - 1 + namedAttrs.size(); - - Node.JspAttribute[] jspAttrs = new Node.JspAttribute[jspAttrSize]; - int jspAttrIndex = 0; - - // Process XML-style attributes - for (int i = 0; i < xmlAttrLen; i++) { - if ("name".equals(attrs.getLocalName(i))) { - n.setNameAttribute(getJspAttribute(null, attrs.getQName(i), - attrs.getURI(i), attrs.getLocalName(i), attrs - .getValue(i), java.lang.String.class, n, - false)); - } else { - if (jspAttrIndex < jspAttrSize) { - jspAttrs[jspAttrIndex++] = getJspAttribute(null, attrs - .getQName(i), attrs.getURI(i), attrs - .getLocalName(i), attrs.getValue(i), - java.lang.Object.class, n, false); - } - } - } - if (n.getNameAttribute() == null) { - err.jspError(n, "jsp.error.jspelement.missing.name"); - } - - // Process named attributes - for (int i = 0; i < namedAttrs.size(); i++) { - Node.NamedAttribute na = (Node.NamedAttribute) namedAttrs - .getNode(i); - jspAttrs[jspAttrIndex++] = new Node.JspAttribute(na, null, - false); - } - - n.setJspAttributes(jspAttrs); - - visitBody(n); - } - - public void visit(Node.JspOutput n) throws JasperException { - JspUtil.checkAttributes("jsp:output", n, jspOutputAttrs, err); - - if (n.getBody() != null) { - err.jspError(n, "jsp.error.jspoutput.nonemptybody"); - } - - String omitXmlDecl = n.getAttributeValue("omit-xml-declaration"); - String doctypeName = n.getAttributeValue("doctype-root-element"); - String doctypePublic = n.getAttributeValue("doctype-public"); - String doctypeSystem = n.getAttributeValue("doctype-system"); - - String omitXmlDeclOld = pageInfo.getOmitXmlDecl(); - String doctypeNameOld = pageInfo.getDoctypeName(); - String doctypePublicOld = pageInfo.getDoctypePublic(); - String doctypeSystemOld = pageInfo.getDoctypeSystem(); - - if (omitXmlDecl != null && omitXmlDeclOld != null - && !omitXmlDecl.equals(omitXmlDeclOld)) { - err.jspError(n, "jsp.error.jspoutput.conflict", - "omit-xml-declaration", omitXmlDeclOld, omitXmlDecl); - } - - if (doctypeName != null && doctypeNameOld != null - && !doctypeName.equals(doctypeNameOld)) { - err.jspError(n, "jsp.error.jspoutput.conflict", - "doctype-root-element", doctypeNameOld, doctypeName); - } - - if (doctypePublic != null && doctypePublicOld != null - && !doctypePublic.equals(doctypePublicOld)) { - err.jspError(n, "jsp.error.jspoutput.conflict", - "doctype-public", doctypePublicOld, doctypePublic); - } - - if (doctypeSystem != null && doctypeSystemOld != null - && !doctypeSystem.equals(doctypeSystemOld)) { - err.jspError(n, "jsp.error.jspoutput.conflict", - "doctype-system", doctypeSystemOld, doctypeSystem); - } - - if (doctypeName == null && doctypeSystem != null - || doctypeName != null && doctypeSystem == null) { - err.jspError(n, "jsp.error.jspoutput.doctypenamesystem"); - } - - if (doctypePublic != null && doctypeSystem == null) { - err.jspError(n, "jsp.error.jspoutput.doctypepulicsystem"); - } - - if (omitXmlDecl != null) { - pageInfo.setOmitXmlDecl(omitXmlDecl); - } - if (doctypeName != null) { - pageInfo.setDoctypeName(doctypeName); - } - if (doctypeSystem != null) { - pageInfo.setDoctypeSystem(doctypeSystem); - } - if (doctypePublic != null) { - pageInfo.setDoctypePublic(doctypePublic); - } - } - - public void visit(Node.InvokeAction n) throws JasperException { - - JspUtil.checkAttributes("Invoke", n, invokeAttrs, err); - - String scope = n.getTextAttribute("scope"); - JspUtil.checkScope(scope, n, err); - - String var = n.getTextAttribute("var"); - String varReader = n.getTextAttribute("varReader"); - if (scope != null && var == null && varReader == null) { - err.jspError(n, "jsp.error.missing_var_or_varReader"); - } - if (var != null && varReader != null) { - err.jspError(n, "jsp.error.var_and_varReader"); - } - } - - public void visit(Node.DoBodyAction n) throws JasperException { - - JspUtil.checkAttributes("DoBody", n, doBodyAttrs, err); - - String scope = n.getTextAttribute("scope"); - JspUtil.checkScope(scope, n, err); - - String var = n.getTextAttribute("var"); - String varReader = n.getTextAttribute("varReader"); - if (scope != null && var == null && varReader == null) { - err.jspError(n, "jsp.error.missing_var_or_varReader"); - } - if (var != null && varReader != null) { - err.jspError(n, "jsp.error.var_and_varReader"); - } - } - - /* - * Make sure the given custom action does not have any invalid - * attributes. - * - * A custom action and its declared attributes always belong to the same - * namespace, which is identified by the prefix name of the custom tag - * invocation. For example, in this invocation: - * - * , the action - * - * "test" and its attributes "a", "b", and "c" all belong to the - * namespace identified by the prefix "my". The above invocation would - * be equivalent to: - * - * - * - * An action attribute may have a prefix different from that of the - * action invocation only if the underlying tag handler supports dynamic - * attributes, in which case the attribute with the different prefix is - * considered a dynamic attribute. - */ - private void checkXmlAttributes(Node.CustomTag n, - Node.JspAttribute[] jspAttrs, Hashtable tagDataAttrs) - throws JasperException { - - TagInfo tagInfo = n.getTagInfo(); - if (tagInfo == null) { - err.jspError(n, "jsp.error.missing.tagInfo", n.getQName()); - } - TagAttributeInfo[] tldAttrs = tagInfo.getAttributes(); - Attributes attrs = n.getAttributes(); - - boolean checkDeferred = !pageInfo.isDeferredSyntaxAllowedAsLiteral() - && !(tagInfo.getTagLibrary().getRequiredVersion().equals("2.0") - || tagInfo.getTagLibrary().getRequiredVersion().equals("1.2")); - - for (int i = 0; attrs != null && i < attrs.getLength(); i++) { - boolean found = false; - - boolean runtimeExpression = ((n.getRoot().isXmlSyntax() && attrs.getValue(i).startsWith("%=")) - || (!n.getRoot().isXmlSyntax() && attrs.getValue(i).startsWith("<%="))); - boolean elExpression = false; - boolean deferred = false; - boolean deferredValueIsLiteral = false; - - ELNode.Nodes el = null; - if (!runtimeExpression) { - el = ELParser.parse(attrs.getValue(i)); - Iterator nodes = el.iterator(); - while (nodes.hasNext()) { - ELNode node = nodes.next(); - if (node instanceof ELNode.Root) { - if (((ELNode.Root) node).getType() == '$') { - elExpression = true; - } else if (checkDeferred && ((ELNode.Root) node).getType() == '#') { - elExpression = true; - deferred = true; - if (pageInfo.isELIgnored()) { - deferredValueIsLiteral = true; - } - } - } - } - } - - boolean expression = runtimeExpression - || (elExpression && (!pageInfo.isELIgnored() || (!"true".equalsIgnoreCase(pageInfo.getIsELIgnored()) && checkDeferred && deferred))); - - for (int j = 0; tldAttrs != null && j < tldAttrs.length; j++) { - if (attrs.getLocalName(i).equals(tldAttrs[j].getName()) - && (attrs.getURI(i) == null - || attrs.getURI(i).length() == 0 || attrs - .getURI(i).equals(n.getURI()))) { - - if (tldAttrs[j].canBeRequestTime() - || tldAttrs[j].isDeferredMethod() || tldAttrs[j].isDeferredValue()) { // JSP 2.1 - - if (!expression) { - - if (deferredValueIsLiteral && !pageInfo.isDeferredSyntaxAllowedAsLiteral()) { - err.jspError(n, "jsp.error.attribute.custom.non_rt_with_expr", - tldAttrs[j].getName()); - } - - String expectedType = null; - if (tldAttrs[j].isDeferredMethod()) { - // The String litteral must be castable to what is declared as type - // for the attribute - String m = tldAttrs[j].getMethodSignature(); - if (m != null) { - int rti = m.trim().indexOf(' '); - if (rti > 0) { - expectedType = m.substring(0, rti).trim(); - } - } else { - expectedType = "java.lang.Object"; - } - } - if (tldAttrs[j].isDeferredValue()) { - // The String litteral must be castable to what is declared as type - // for the attribute - expectedType = tldAttrs[j].getExpectedTypeName(); - } - if (expectedType != null) { - Class expectedClass = String.class; - try { - expectedClass = JspUtil.toClass(expectedType, loader); - } catch (ClassNotFoundException e) { - err.jspError - (n, "jsp.error.unknown_attribute_type", - tldAttrs[j].getName(), expectedType); - } - // Check casting - try { - ELSupport.checkType(attrs.getValue(i), expectedClass); - } catch (Exception e) { - err.jspError - (n, "jsp.error.coerce_to_type", - tldAttrs[j].getName(), expectedType, attrs.getValue(i)); - } - } - - jspAttrs[i] = new Node.JspAttribute(tldAttrs[j], - attrs.getQName(i), attrs.getURI(i), attrs - .getLocalName(i), - attrs.getValue(i), false, null, false); - } else { - - if (deferred && !tldAttrs[j].isDeferredMethod() && !tldAttrs[j].isDeferredValue()) { - // No deferred expressions allowed for this attribute - err.jspError(n, "jsp.error.attribute.custom.non_rt_with_expr", - tldAttrs[j].getName()); - } - if (!deferred && !tldAttrs[j].canBeRequestTime()) { - // Only deferred expressions are allowed for this attribute - err.jspError(n, "jsp.error.attribute.custom.non_rt_with_expr", - tldAttrs[j].getName()); - } - - Class expectedType = String.class; - try { - String typeStr = tldAttrs[j].getTypeName(); - if (tldAttrs[j].isFragment()) { - expectedType = JspFragment.class; - } else if (typeStr != null) { - expectedType = JspUtil.toClass(typeStr, - loader); - } - if (elExpression) { - // El expression - validateFunctions(el, n); - jspAttrs[i] = new Node.JspAttribute(tldAttrs[j], - attrs.getQName(i), attrs.getURI(i), - attrs.getLocalName(i), - attrs.getValue(i), false, el, false); - ELContextImpl ctx = new ELContextImpl(); - ctx.setFunctionMapper(getFunctionMapper(el)); - try { - jspAttrs[i].validateEL(this.pageInfo.getExpressionFactory(), ctx); - } catch (ELException e) { - this.err.jspError(n.getStart(), - "jsp.error.invalid.expression", - attrs.getValue(i), e.toString()); - } - } else { - // Runtime expression - jspAttrs[i] = getJspAttribute(tldAttrs[j], - attrs.getQName(i), attrs.getURI(i), - attrs.getLocalName(i), attrs - .getValue(i), expectedType, n, - false); - } - } catch (ClassNotFoundException e) { - err.jspError - (n, "jsp.error.unknown_attribute_type", - tldAttrs[j].getName(), tldAttrs[j].getTypeName()); - } - } - - } else { - // Attribute does not accept any expressions. - // Make sure its value does not contain any. - if (expression) { - err.jspError(n, "jsp.error.attribute.custom.non_rt_with_expr", - tldAttrs[j].getName()); - } - jspAttrs[i] = new Node.JspAttribute(tldAttrs[j], - attrs.getQName(i), attrs.getURI(i), attrs - .getLocalName(i), - attrs.getValue(i), false, null, false); - } - if (expression) { - tagDataAttrs.put(attrs.getQName(i), - TagData.REQUEST_TIME_VALUE); - } else { - tagDataAttrs.put(attrs.getQName(i), attrs - .getValue(i)); - } - found = true; - break; - } - } - if (!found) { - if (tagInfo.hasDynamicAttributes()) { - jspAttrs[i] = getJspAttribute(null, attrs.getQName(i), - attrs.getURI(i), attrs.getLocalName(i), attrs - .getValue(i), java.lang.Object.class, - n, true); - } else { - err.jspError(n, "jsp.error.bad_attribute", attrs - .getQName(i), n.getLocalName()); - } - } - } - } - - /* - * Make sure the given custom action does not have any invalid named - * attributes - */ - private void checkNamedAttributes(Node.CustomTag n, - Node.JspAttribute[] jspAttrs, int start, - Hashtable tagDataAttrs) - throws JasperException { - - TagInfo tagInfo = n.getTagInfo(); - if (tagInfo == null) { - err.jspError(n, "jsp.error.missing.tagInfo", n.getQName()); - } - TagAttributeInfo[] tldAttrs = tagInfo.getAttributes(); - Node.Nodes naNodes = n.getNamedAttributeNodes(); - - for (int i = 0; i < naNodes.size(); i++) { - Node.NamedAttribute na = (Node.NamedAttribute) naNodes - .getNode(i); - boolean found = false; - for (int j = 0; j < tldAttrs.length; j++) { - /* - * See above comment about namespace matches. For named - * attributes, we use the prefix instead of URI as the match - * criterion, because in the case of a JSP document, we'd - * have to keep track of which namespaces are in scope when - * parsing a named attribute, in order to determine the URI - * that the prefix of the named attribute's name matches to. - */ - String attrPrefix = na.getPrefix(); - if (na.getLocalName().equals(tldAttrs[j].getName()) - && (attrPrefix == null || attrPrefix.length() == 0 || attrPrefix - .equals(n.getPrefix()))) { - jspAttrs[start + i] = new Node.JspAttribute(na, - tldAttrs[j], false); - NamedAttributeVisitor nav = null; - if (na.getBody() != null) { - nav = new NamedAttributeVisitor(); - na.getBody().visit(nav); - } - if (nav != null && nav.hasDynamicContent()) { - tagDataAttrs.put(na.getName(), - TagData.REQUEST_TIME_VALUE); - } else { - tagDataAttrs.put(na.getName(), na.getText()); - } - found = true; - break; - } - } - if (!found) { - if (tagInfo.hasDynamicAttributes()) { - jspAttrs[start + i] = new Node.JspAttribute(na, null, - true); - } else { - err.jspError(n, "jsp.error.bad_attribute", - na.getName(), n.getLocalName()); - } - } - } - } - - /** - * Preprocess attributes that can be expressions. Expression delimiters - * are stripped. - *

- * If value is null, checks if there are any NamedAttribute subelements - * in the tree node, and if so, constructs a JspAttribute out of a child - * NamedAttribute node. - */ - private Node.JspAttribute getJspAttribute(TagAttributeInfo tai, - String qName, String uri, String localName, String value, - Class expectedType, Node n, boolean dynamic) - throws JasperException { - - Node.JspAttribute result = null; - - // XXX Is it an error to see "%=foo%" in non-Xml page? - // (We won't see "<%=foo%> in xml page because '<' is not a - // valid attribute value in xml). - - if (value != null) { - if (n.getRoot().isXmlSyntax() && value.startsWith("%=")) { - result = new Node.JspAttribute(tai, qName, uri, localName, - value.substring(2, value.length() - 1), true, null, - dynamic); - } else if (!n.getRoot().isXmlSyntax() - && value.startsWith("<%=")) { - result = new Node.JspAttribute(tai, qName, uri, localName, - value.substring(3, value.length() - 2), true, null, - dynamic); - } else { - // The attribute can contain expressions but is not a - // scriptlet expression; thus, we want to run it through - // the expression interpreter - - // validate expression syntax if string contains - // expression(s) - ELNode.Nodes el = ELParser.parse(value); - - boolean deferred = false; - Iterator nodes = el.iterator(); - while (nodes.hasNext()) { - ELNode node = nodes.next(); - if (node instanceof ELNode.Root) { - if (((ELNode.Root) node).getType() == '#') { - deferred = true; - } - } - } - - if (el.containsEL() && !pageInfo.isELIgnored() - && ((!pageInfo.isDeferredSyntaxAllowedAsLiteral() && deferred) - || !deferred)) { - - validateFunctions(el, n); - - result = new Node.JspAttribute(tai, qName, uri, - localName, value, false, el, dynamic); - - ELContextImpl ctx = new ELContextImpl(); - ctx.setFunctionMapper(getFunctionMapper(el)); - - try { - result.validateEL(this.pageInfo - .getExpressionFactory(), ctx); - } catch (ELException e) { - this.err.jspError(n.getStart(), - "jsp.error.invalid.expression", value, e - .toString()); - } - - } else { - result = new Node.JspAttribute(tai, qName, uri, - localName, value, false, null, dynamic); - } - } - } else { - // Value is null. Check for any NamedAttribute subnodes - // that might contain the value for this attribute. - // Otherwise, the attribute wasn't found so we return null. - - Node.NamedAttribute namedAttributeNode = n - .getNamedAttributeNode(qName); - if (namedAttributeNode != null) { - result = new Node.JspAttribute(namedAttributeNode, tai, - dynamic); - } - } - - return result; - } - - /* - * Return an empty StringBuffer [not thread-safe] - */ - private StringBuffer getBuffer() { - this.buf.setLength(0); - return this.buf; - } - - /* - * Checks to see if the given attribute value represents a runtime or EL - * expression. - */ - private boolean isExpression(Node n, String value, boolean checkDeferred) { - - boolean runtimeExpression = ((n.getRoot().isXmlSyntax() && value.startsWith("%=")) - || (!n.getRoot().isXmlSyntax() && value.startsWith("<%="))); - boolean elExpression = false; - - if (!runtimeExpression && !pageInfo.isELIgnored()) { - Iterator nodes = ELParser.parse(value).iterator(); - while (nodes.hasNext()) { - ELNode node = nodes.next(); - if (node instanceof ELNode.Root) { - if (((ELNode.Root) node).getType() == '$') { - elExpression = true; - } else if (checkDeferred && !pageInfo.isDeferredSyntaxAllowedAsLiteral() - && ((ELNode.Root) node).getType() == '#') { - elExpression = true; - } - } - } - } - - return runtimeExpression || elExpression; - - } - - /* - * Throws exception if the value of the attribute with the given name in - * the given node is given as an RT or EL expression, but the spec - * requires a static value. - */ - private void throwErrorIfExpression(Node n, String attrName, - String actionName) throws JasperException { - if (n.getAttributes() != null - && n.getAttributes().getValue(attrName) != null - && isExpression(n, n.getAttributes().getValue(attrName), true)) { - err.jspError(n, - "jsp.error.attribute.standard.non_rt_with_expr", - attrName, actionName); - } - } - - private static class NamedAttributeVisitor extends Node.Visitor { - private boolean hasDynamicContent; - - public void doVisit(Node n) throws JasperException { - if (!(n instanceof Node.JspText) - && !(n instanceof Node.TemplateText)) { - hasDynamicContent = true; - } - visitBody(n); - } - - public boolean hasDynamicContent() { - return hasDynamicContent; - } - } - - private String findUri(String prefix, Node n) { - - for (Node p = n; p != null; p = p.getParent()) { - Attributes attrs = p.getTaglibAttributes(); - if (attrs == null) { - continue; - } - for (int i = 0; i < attrs.getLength(); i++) { - String name = attrs.getQName(i); - int k = name.indexOf(':'); - if (prefix == null && k < 0) { - // prefix not specified and a default ns found - return attrs.getValue(i); - } - if (prefix != null && k >= 0 - && prefix.equals(name.substring(k + 1))) { - return attrs.getValue(i); - } - } - } - return null; - } - - /** - * Validate functions in EL expressions - */ - private void validateFunctions(ELNode.Nodes el, Node n) - throws JasperException { - - class FVVisitor extends ELNode.Visitor { - - Node n; - - FVVisitor(Node n) { - this.n = n; - } - - public void visit(ELNode.Function func) throws JasperException { - String prefix = func.getPrefix(); - String function = func.getName(); - String uri = null; - - if (n.getRoot().isXmlSyntax()) { - uri = findUri(prefix, n); - } else if (prefix != null) { - uri = pageInfo.getURI(prefix); - } - - if (uri == null) { - if (prefix == null) { - err.jspError(n, "jsp.error.noFunctionPrefix", - function); - } else { - err - .jspError( - n, - "jsp.error.attribute.invalidPrefix", - prefix); - } - } - TagLibraryInfo taglib = pageInfo.getTaglib(uri); - FunctionInfo funcInfo = null; - if (taglib != null) { - funcInfo = taglib.getFunction(function); - } - if (funcInfo == null) { - err.jspError(n, "jsp.error.noFunction", function); - } - // Skip TLD function uniqueness check. Done by Schema ? - func.setUri(uri); - func.setFunctionInfo(funcInfo); - processSignature(func); - } - } - - el.visit(new FVVisitor(n)); - } - - private void prepareExpression(ELNode.Nodes el, Node n, String expr) - throws JasperException { - validateFunctions(el, n); - - // test it out - ELContextImpl ctx = new ELContextImpl(); - ctx.setFunctionMapper(this.getFunctionMapper(el)); - ExpressionFactory ef = this.pageInfo.getExpressionFactory(); - try { - ef.createValueExpression(ctx, expr, Object.class); - } catch (ELException e) { - - } - } - - private void processSignature(ELNode.Function func) - throws JasperException { - func.setMethodName(getMethod(func)); - func.setParameters(getParameters(func)); - } - - /** - * Get the method name from the signature. - */ - private String getMethod(ELNode.Function func) throws JasperException { - FunctionInfo funcInfo = func.getFunctionInfo(); - String signature = funcInfo.getFunctionSignature(); - - int start = signature.indexOf(' '); - if (start < 0) { - err.jspError("jsp.error.tld.fn.invalid.signature", func - .getPrefix(), func.getName()); - } - int end = signature.indexOf('('); - if (end < 0) { - err.jspError( - "jsp.error.tld.fn.invalid.signature.parenexpected", - func.getPrefix(), func.getName()); - } - return signature.substring(start + 1, end).trim(); - } - - /** - * Get the parameters types from the function signature. - * - * @return An array of parameter class names - */ - private String[] getParameters(ELNode.Function func) - throws JasperException { - FunctionInfo funcInfo = func.getFunctionInfo(); - String signature = funcInfo.getFunctionSignature(); - ArrayList params = new ArrayList(); - // Signature is of the form - // S ( ',' )* )? ')' - int start = signature.indexOf('(') + 1; - boolean lastArg = false; - while (true) { - int p = signature.indexOf(',', start); - if (p < 0) { - p = signature.indexOf(')', start); - if (p < 0) { - err.jspError("jsp.error.tld.fn.invalid.signature", func - .getPrefix(), func.getName()); - } - lastArg = true; - } - String arg = signature.substring(start, p).trim(); - if (!"".equals(arg)) { - params.add(arg); - } - if (lastArg) { - break; - } - start = p + 1; - } - return (String[]) params.toArray(new String[params.size()]); - } - - private FunctionMapper getFunctionMapper(ELNode.Nodes el) - throws JasperException { - - class ValidateFunctionMapper extends FunctionMapper { - - private HashMap fnmap = new HashMap(); - - public void mapFunction(String fnQName, Method method) { - fnmap.put(fnQName, method); - } - - public Method resolveFunction(String prefix, String localName) { - return this.fnmap.get(prefix + ":" + localName); - } - } - - class MapperELVisitor extends ELNode.Visitor { - ValidateFunctionMapper fmapper; - - MapperELVisitor(ValidateFunctionMapper fmapper) { - this.fmapper = fmapper; - } - - public void visit(ELNode.Function n) throws JasperException { - - Class c = null; - Method method = null; - try { - c = loader.loadClass(n.getFunctionInfo() - .getFunctionClass()); - } catch (ClassNotFoundException e) { - err.jspError("jsp.error.function.classnotfound", n - .getFunctionInfo().getFunctionClass(), n - .getPrefix() - + ':' + n.getName(), e.getMessage()); - } - String paramTypes[] = n.getParameters(); - int size = paramTypes.length; - Class params[] = new Class[size]; - int i = 0; - try { - for (i = 0; i < size; i++) { - params[i] = JspUtil.toClass(paramTypes[i], loader); - } - method = c.getDeclaredMethod(n.getMethodName(), params); - } catch (ClassNotFoundException e) { - err.jspError("jsp.error.signature.classnotfound", - paramTypes[i], n.getPrefix() + ':' - + n.getName(), e.getMessage()); - } catch (NoSuchMethodException e) { - err.jspError("jsp.error.noFunctionMethod", n - .getMethodName(), n.getName(), c.getName()); - } - fmapper.mapFunction(n.getPrefix() + ':' + n.getName(), - method); - } - } - - ValidateFunctionMapper fmapper = new ValidateFunctionMapper(); - el.visit(new MapperELVisitor(fmapper)); - return fmapper; - } - } // End of ValidateVisitor - - /** - * A visitor for validating TagExtraInfo classes of all tags - */ - static class TagExtraInfoVisitor extends Node.Visitor { - - private ErrorDispatcher err; - - /* - * Constructor - */ - TagExtraInfoVisitor(Compiler compiler) { - this.err = compiler.getErrorDispatcher(); - } - - public void visit(Node.CustomTag n) throws JasperException { - TagInfo tagInfo = n.getTagInfo(); - if (tagInfo == null) { - err.jspError(n, "jsp.error.missing.tagInfo", n.getQName()); - } - - ValidationMessage[] errors = tagInfo.validate(n.getTagData()); - if (errors != null && errors.length != 0) { - StringBuffer errMsg = new StringBuffer(); - errMsg.append("

"); - errMsg.append(Localizer.getMessage( - "jsp.error.tei.invalid.attributes", n.getQName())); - errMsg.append("

"); - for (int i = 0; i < errors.length; i++) { - errMsg.append("

"); - if (errors[i].getId() != null) { - errMsg.append(errors[i].getId()); - errMsg.append(": "); - } - errMsg.append(errors[i].getMessage()); - errMsg.append("

"); - } - - err.jspError(n, errMsg.toString()); - } - - visitBody(n); - } - } - - public static void validateDirectives(Compiler compiler, Node.Nodes page) - throws JasperException { - page.visit(new DirectiveVisitor(compiler)); - } - - public static void validateExDirectives(Compiler compiler, Node.Nodes page) - throws JasperException { - // Determine the default output content type - PageInfo pageInfo = compiler.getPageInfo(); - String contentType = pageInfo.getContentType(); - - if (contentType == null || contentType.indexOf("charset=") < 0) { - boolean isXml = page.getRoot().isXmlSyntax(); - String defaultType; - if (contentType == null) { - defaultType = isXml ? "text/xml" : "text/html"; - } else { - defaultType = contentType; - } - - String charset = null; - if (isXml) { - charset = "UTF-8"; - } else { - if (!page.getRoot().isDefaultPageEncoding()) { - charset = page.getRoot().getPageEncoding(); - } - } - - if (charset != null) { - pageInfo.setContentType(defaultType + ";charset=" + charset); - } else { - pageInfo.setContentType(defaultType); - } - } - - /* - * Validate all other nodes. This validation step includes checking a - * custom tag's mandatory and optional attributes against information in - * the TLD (first validation step for custom tags according to - * JSP.10.5). - */ - page.visit(new ValidateVisitor(compiler)); - - /* - * Invoke TagLibraryValidator classes of all imported tags (second - * validation step for custom tags according to JSP.10.5). - */ - validateXmlView(new PageDataImpl(page, compiler), compiler); - - /* - * Invoke TagExtraInfo method isValid() for all imported tags (third - * validation step for custom tags according to JSP.10.5). - */ - page.visit(new TagExtraInfoVisitor(compiler)); - - } - - // ********************************************************************* - // Private (utility) methods - - /** - * Validate XML view against the TagLibraryValidator classes of all imported - * tag libraries. - */ - private static void validateXmlView(PageData xmlView, Compiler compiler) - throws JasperException { - - StringBuffer errMsg = null; - ErrorDispatcher errDisp = compiler.getErrorDispatcher(); - - for (Iterator iter = compiler.getPageInfo().getTaglibs().iterator(); iter - .hasNext();) { - - Object o = iter.next(); - if (!(o instanceof TagLibraryInfoImpl)) - continue; - TagLibraryInfoImpl tli = (TagLibraryInfoImpl) o; - - ValidationMessage[] errors = tli.validate(xmlView); - if ((errors != null) && (errors.length != 0)) { - if (errMsg == null) { - errMsg = new StringBuffer(); - } - errMsg.append("

"); - errMsg.append(Localizer.getMessage( - "jsp.error.tlv.invalid.page", tli.getShortName(), - compiler.getPageInfo().getJspFile())); - errMsg.append("

"); - for (int i = 0; i < errors.length; i++) { - if (errors[i] != null) { - errMsg.append("

"); - errMsg.append(errors[i].getId()); - errMsg.append(": "); - errMsg.append(errors[i].getMessage()); - errMsg.append("

"); - } - } - } - } - - if (errMsg != null) { - errDisp.jspError(errMsg.toString()); - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/tagplugin/TagPlugin.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/tagplugin/TagPlugin.java deleted file mode 100644 index 49cbc7c0f..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/tagplugin/TagPlugin.java +++ /dev/null @@ -1,37 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler.tagplugin; - -/** - * This interface is to be implemented by the plugin author, to supply - * an alternate implementation of the tag handlers. It can be used to - * specify the Java codes to be generated when a tag is invoked. - * - * An implementation of this interface must be registered in a file - * named "tagPlugins.xml" under WEB-INF. - */ - -public interface TagPlugin { - - /** - * Generate codes for a custom tag. - * @param ctxt a TagPluginContext for accessing Jasper functions - */ - void doTag(TagPluginContext ctxt); -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/tagplugin/TagPluginContext.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/tagplugin/TagPluginContext.java deleted file mode 100644 index 8d1c558d1..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/compiler/tagplugin/TagPluginContext.java +++ /dev/null @@ -1,124 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.compiler.tagplugin; - - -/** - * This interface allows the plugin author to make inqueries about the - * properties of the current tag, and to use Jasper resources to generate - * direct Java codes in place of tag handler invocations. - */ - -public interface TagPluginContext { - /** - * @return true if the body of the tag is scriptless. - */ - boolean isScriptless(); - - /** - * @param attribute Name of the attribute - * @return true if the attribute is specified in the tag - */ - boolean isAttributeSpecified(String attribute); - - /** - * @return An unique temporary variable name that the plugin can use. - */ - String getTemporaryVariableName(); - - /** - * Generate an import statement - * @param s Name of the import class, '*' allowed. - */ - void generateImport(String s); - - /** - * Generate a declaration in the of the generated class. This can be - * used to declare an innter class, a method, or a class variable. - * @param id An unique ID identifying the declaration. It is not - * part of the declaration, and is used to ensure that the - * declaration will only appear once. If this method is - * invoked with the same id more than once in the translation - * unit, only the first declaration will be taken. - * @param text The text of the declaration. - **/ - void generateDeclaration(String id, String text); - - /** - * Generate Java source codes - */ - void generateJavaSource(String s); - - /** - * @return true if the attribute is specified and its value is a - * translation-time constant. - */ - boolean isConstantAttribute(String attribute); - - /** - * @return A string that is the value of a constant attribute. Undefined - * if the attribute is not a (translation-time) constant. - * null if the attribute is not specified. - */ - String getConstantAttribute(String attribute); - - /** - * Generate codesto evaluate value of a attribute in the custom tag - * The codes is a Java expression. - * NOTE: Currently cannot handle attributes that are fragments. - * @param attribute The specified attribute - */ - void generateAttribute(String attribute); - - /** - * Generate codes for the body of the custom tag - */ - void generateBody(); - - /** - * Abandon optimization for this tag handler, and instruct - * Jasper to generate the tag handler calls, as usual. - * Should be invoked if errors are detected, or when the tag body - * is deemed too compilicated for optimization. - */ - void dontUseTagPlugin(); - - /** - * Get the PluginContext for the parent of this custom tag. NOTE: - * The operations available for PluginContext so obtained is limited - * to getPluginAttribute and setPluginAttribute, and queries (e.g. - * isScriptless(). There should be no calls to generate*(). - * @return The pluginContext for the parent node. - * null if the parent is not a custom tag, or if the pluginConxt - * if not available (because useTagPlugin is false, e.g). - */ - TagPluginContext getParentContext(); - - /** - * Associate the attribute with a value in the current tagplugin context. - * The plugin attributes can be used for communication among tags that - * must work together as a group. See for an example. - */ - void setPluginAttribute(String attr, Object value); - - /** - * Get the value of an attribute in the current tagplugin context. - */ - Object getPluginAttribute(String attr); -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELContextImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELContextImpl.java deleted file mode 100644 index 34e550c89..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELContextImpl.java +++ /dev/null @@ -1,99 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import java.lang.reflect.Method; -import java.util.HashMap; -import java.util.Map; - -import javax.el.ELContext; -import javax.el.ELResolver; -import javax.el.FunctionMapper; -import javax.el.ValueExpression; -import javax.el.VariableMapper; - -/** - * Implementation of ELContext - * - * @author Jacob Hookom - */ -public final class ELContextImpl extends ELContext { - - private final static FunctionMapper NullFunctionMapper = new FunctionMapper() { - public Method resolveFunction(String prefix, String localName) { - return null; - } - }; - - private final static class VariableMapperImpl extends VariableMapper { - - private Map vars; - - public ValueExpression resolveVariable(String variable) { - if (vars == null) { - return null; - } - return vars.get(variable); - } - - public ValueExpression setVariable(String variable, - ValueExpression expression) { - if (vars == null) - vars = new HashMap(); - return vars.put(variable, expression); - } - - } - - private final ELResolver resolver; - - private FunctionMapper functionMapper = NullFunctionMapper; // immutable - - private VariableMapper variableMapper; - - public ELContextImpl() { - this(ELResolverImpl.DefaultResolver); - } - - public ELContextImpl(ELResolver resolver) { - this.resolver = resolver; - } - - public ELResolver getELResolver() { - return this.resolver; - } - - public FunctionMapper getFunctionMapper() { - return this.functionMapper; - } - - public VariableMapper getVariableMapper() { - if (this.variableMapper == null) { - this.variableMapper = new VariableMapperImpl(); - } - return this.variableMapper; - } - - public void setFunctionMapper(FunctionMapper functionMapper) { - this.functionMapper = functionMapper; - } - - public void setVariableMapper(VariableMapper variableMapper) { - this.variableMapper = variableMapper; - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELContextWrapper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELContextWrapper.java deleted file mode 100644 index a0754c3ef..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELContextWrapper.java +++ /dev/null @@ -1,78 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import java.util.Locale; - -import javax.el.ELContext; -import javax.el.ELResolver; -import javax.el.FunctionMapper; -import javax.el.VariableMapper; - -/** - * Simple ELContextWrapper for runtime evaluation of EL w/ dynamic FunctionMappers - * - * @author jhook - */ -public final class ELContextWrapper extends ELContext { - - private final ELContext target; - private final FunctionMapper fnMapper; - - public ELContextWrapper(ELContext target, FunctionMapper fnMapper) { - this.target = target; - this.fnMapper = fnMapper; - } - - public ELResolver getELResolver() { - return this.target.getELResolver(); - } - - public FunctionMapper getFunctionMapper() { - if (this.fnMapper != null) return this.fnMapper; - return this.target.getFunctionMapper(); - } - - public VariableMapper getVariableMapper() { - return this.target.getVariableMapper(); - } - - public Object getContext(Class key) { - return this.target.getContext(key); - } - - public Locale getLocale() { - return this.target.getLocale(); - } - - public boolean isPropertyResolved() { - return this.target.isPropertyResolved(); - } - - public void putContext(Class key, Object contextObject) throws NullPointerException { - this.target.putContext(key, contextObject); - } - - public void setLocale(Locale locale) { - this.target.setLocale(locale); - } - - public void setPropertyResolved(boolean resolved) { - this.target.setPropertyResolved(resolved); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELResolverImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELResolverImpl.java deleted file mode 100644 index 0c1309502..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ELResolverImpl.java +++ /dev/null @@ -1,146 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.el; - -import java.util.Iterator; - -import javax.el.ArrayELResolver; -import javax.el.BeanELResolver; -import javax.el.CompositeELResolver; -import javax.el.ELContext; -import javax.el.ELException; -import javax.el.ELResolver; -import javax.el.ListELResolver; -import javax.el.MapELResolver; -import javax.el.PropertyNotFoundException; -import javax.el.PropertyNotWritableException; -import javax.el.ResourceBundleELResolver; -import javax.servlet.jsp.el.VariableResolver; - -public final class ELResolverImpl extends ELResolver { - - public final static ELResolver DefaultResolver = new CompositeELResolver(); - - static { - ((CompositeELResolver) DefaultResolver).add(new MapELResolver()); - ((CompositeELResolver) DefaultResolver).add(new ResourceBundleELResolver()); - ((CompositeELResolver) DefaultResolver).add(new ListELResolver()); - ((CompositeELResolver) DefaultResolver).add(new ArrayELResolver()); - ((CompositeELResolver) DefaultResolver).add(new BeanELResolver()); - } - - private final VariableResolver variableResolver; - - public ELResolverImpl(VariableResolver variableResolver) { - this.variableResolver = variableResolver; - } - - public Object getValue(ELContext context, Object base, Object property) - throws NullPointerException, PropertyNotFoundException, ELException { - if (context == null) { - throw new NullPointerException(); - } - - if (base == null) { - context.setPropertyResolved(true); - if (property != null) { - try { - return this.variableResolver.resolveVariable(property - .toString()); - } catch (javax.servlet.jsp.el.ELException e) { - throw new ELException(e.getMessage(), e.getCause()); - } - } - } - - if (!context.isPropertyResolved()) { - return DefaultResolver.getValue(context, base, property); - } - return null; - } - - public Class getType(ELContext context, Object base, Object property) - throws NullPointerException, PropertyNotFoundException, ELException { - if (context == null) { - throw new NullPointerException(); - } - - if (base == null) { - context.setPropertyResolved(true); - if (property != null) { - try { - Object obj = this.variableResolver.resolveVariable(property - .toString()); - return (obj != null) ? obj.getClass() : null; - } catch (javax.servlet.jsp.el.ELException e) { - throw new ELException(e.getMessage(), e.getCause()); - } - } - } - - if (!context.isPropertyResolved()) { - return DefaultResolver.getType(context, base, property); - } - return null; - } - - public void setValue(ELContext context, Object base, Object property, - Object value) throws NullPointerException, - PropertyNotFoundException, PropertyNotWritableException, - ELException { - if (context == null) { - throw new NullPointerException(); - } - - if (base == null) { - context.setPropertyResolved(true); - throw new PropertyNotWritableException( - "Legacy VariableResolver wrapped, not writable"); - } - - if (!context.isPropertyResolved()) { - DefaultResolver.setValue(context, base, property, value); - } - } - - public boolean isReadOnly(ELContext context, Object base, Object property) - throws NullPointerException, PropertyNotFoundException, ELException { - if (context == null) { - throw new NullPointerException(); - } - - if (base == null) { - context.setPropertyResolved(true); - return true; - } - - return DefaultResolver.isReadOnly(context, base, property); - } - - public Iterator getFeatureDescriptors(ELContext context, Object base) { - return DefaultResolver.getFeatureDescriptors(context, base); - } - - public Class getCommonPropertyType(ELContext context, Object base) { - if (base == null) { - return String.class; - } - return DefaultResolver.getCommonPropertyType(context, base); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ExpressionEvaluatorImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ExpressionEvaluatorImpl.java deleted file mode 100644 index 21dbefce3..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ExpressionEvaluatorImpl.java +++ /dev/null @@ -1,58 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import javax.el.ELContext; -import javax.el.ExpressionFactory; -import javax.el.ValueExpression; -import javax.servlet.jsp.el.ELException; -import javax.servlet.jsp.el.ELParseException; -import javax.servlet.jsp.el.Expression; -import javax.servlet.jsp.el.ExpressionEvaluator; -import javax.servlet.jsp.el.FunctionMapper; -import javax.servlet.jsp.el.VariableResolver; - - -public final class ExpressionEvaluatorImpl extends ExpressionEvaluator { - - private final ExpressionFactory factory; - - public ExpressionEvaluatorImpl(ExpressionFactory factory) { - this.factory = factory; - } - - public Expression parseExpression(String expression, Class expectedType, - FunctionMapper fMapper) throws ELException { - try { - ELContextImpl ctx = new ELContextImpl(ELResolverImpl.DefaultResolver); - if (fMapper != null) { - ctx.setFunctionMapper(new FunctionMapperImpl(fMapper)); - } - ValueExpression ve = this.factory.createValueExpression(ctx, expression, expectedType); - return new ExpressionImpl(ve); - } catch (javax.el.ELException e) { - throw new ELParseException(e.getMessage()); - } - } - - public Object evaluate(String expression, Class expectedType, - VariableResolver vResolver, FunctionMapper fMapper) - throws ELException { - return this.parseExpression(expression, expectedType, fMapper).evaluate(vResolver); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ExpressionImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ExpressionImpl.java deleted file mode 100644 index 107326dfb..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/ExpressionImpl.java +++ /dev/null @@ -1,38 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import javax.el.ELContext; -import javax.el.ValueExpression; -import javax.servlet.jsp.el.ELException; -import javax.servlet.jsp.el.Expression; -import javax.servlet.jsp.el.VariableResolver; - -public final class ExpressionImpl extends Expression { - - private final ValueExpression ve; - - public ExpressionImpl(ValueExpression ve) { - this.ve = ve; - } - - public Object evaluate(VariableResolver vResolver) throws ELException { - ELContext ctx = new ELContextImpl(new ELResolverImpl(vResolver)); - return ve.getValue(ctx); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/FunctionMapperImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/FunctionMapperImpl.java deleted file mode 100644 index 0cf84ecde..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/FunctionMapperImpl.java +++ /dev/null @@ -1,35 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import java.lang.reflect.Method; - -import javax.servlet.jsp.el.FunctionMapper; - -public final class FunctionMapperImpl extends javax.el.FunctionMapper { - - private final FunctionMapper fnMapper; - - public FunctionMapperImpl(FunctionMapper fnMapper) { - this.fnMapper = fnMapper; - } - - public Method resolveFunction(String prefix, String localName) { - return this.fnMapper.resolveFunction(prefix, localName); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspELException.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspELException.java deleted file mode 100644 index c9cf3022f..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspELException.java +++ /dev/null @@ -1,26 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import javax.el.ELException; - -public class JspELException extends ELException { - - public JspELException(String mark, ELException e) { - super(mark + " " + e.getMessage(), e.getCause()); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspMethodExpression.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspMethodExpression.java deleted file mode 100644 index b48e00342..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspMethodExpression.java +++ /dev/null @@ -1,108 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import java.io.Externalizable; -import java.io.IOException; -import java.io.ObjectInput; -import java.io.ObjectOutput; - -import javax.el.ELContext; -import javax.el.ELException; -import javax.el.MethodExpression; -import javax.el.MethodInfo; -import javax.el.MethodNotFoundException; -import javax.el.PropertyNotFoundException; - -public final class JspMethodExpression extends MethodExpression implements - Externalizable { - - private String mark; - - private MethodExpression target; - - public JspMethodExpression() { - super(); - } - - public JspMethodExpression(String mark, MethodExpression target) { - this.target = target; - this.mark = mark; - } - - public MethodInfo getMethodInfo(ELContext context) - throws NullPointerException, PropertyNotFoundException, - MethodNotFoundException, ELException { - try { - return this.target.getMethodInfo(context); - } catch (MethodNotFoundException e) { - if (e instanceof JspMethodNotFoundException) throw e; - throw new JspMethodNotFoundException(this.mark, e); - } catch (PropertyNotFoundException e) { - if (e instanceof JspPropertyNotFoundException) throw e; - throw new JspPropertyNotFoundException(this.mark, e); - } catch (ELException e) { - if (e instanceof JspELException) throw e; - throw new JspELException(this.mark, e); - } - } - - public Object invoke(ELContext context, Object[] params) - throws NullPointerException, PropertyNotFoundException, - MethodNotFoundException, ELException { - try { - return this.target.invoke(context, params); - } catch (MethodNotFoundException e) { - if (e instanceof JspMethodNotFoundException) throw e; - throw new JspMethodNotFoundException(this.mark, e); - } catch (PropertyNotFoundException e) { - if (e instanceof JspPropertyNotFoundException) throw e; - throw new JspPropertyNotFoundException(this.mark, e); - } catch (ELException e) { - if (e instanceof JspELException) throw e; - throw new JspELException(this.mark, e); - } - } - - public boolean equals(Object obj) { - return this.target.equals(obj); - } - - public int hashCode() { - return this.target.hashCode(); - } - - public String getExpressionString() { - return this.target.getExpressionString(); - } - - public boolean isLiteralText() { - return this.target.isLiteralText(); - } - - public void writeExternal(ObjectOutput out) throws IOException { - out.writeUTF(this.mark); - out.writeObject(this.target); - } - - public void readExternal(ObjectInput in) throws IOException, - ClassNotFoundException { - this.mark = in.readUTF(); - this.target = (MethodExpression) in.readObject(); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspMethodNotFoundException.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspMethodNotFoundException.java deleted file mode 100644 index abb9d30ff..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspMethodNotFoundException.java +++ /dev/null @@ -1,26 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import javax.el.MethodNotFoundException; - -public class JspMethodNotFoundException extends MethodNotFoundException { - - public JspMethodNotFoundException(String mark, MethodNotFoundException e) { - super(mark + " " + e.getMessage(), e.getCause()); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspPropertyNotFoundException.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspPropertyNotFoundException.java deleted file mode 100644 index 89ac40b4a..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspPropertyNotFoundException.java +++ /dev/null @@ -1,28 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import javax.el.PropertyNotFoundException; - -public final class JspPropertyNotFoundException extends - PropertyNotFoundException { - - public JspPropertyNotFoundException(String mark, PropertyNotFoundException e) { - super(mark + " " + e.getMessage(), e.getCause()); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspPropertyNotWritableException.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspPropertyNotWritableException.java deleted file mode 100644 index 70507a4a5..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspPropertyNotWritableException.java +++ /dev/null @@ -1,27 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import javax.el.PropertyNotWritableException; - -public class JspPropertyNotWritableException extends - PropertyNotWritableException { - - public JspPropertyNotWritableException(String mark, PropertyNotWritableException e) { - super(mark + " " + e.getMessage(), e.getCause()); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspValueExpression.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspValueExpression.java deleted file mode 100644 index d8c32a072..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/JspValueExpression.java +++ /dev/null @@ -1,137 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import java.io.Externalizable; -import java.io.IOException; -import java.io.ObjectInput; -import java.io.ObjectOutput; - -import javax.el.ELContext; -import javax.el.ELException; -import javax.el.PropertyNotFoundException; -import javax.el.PropertyNotWritableException; -import javax.el.ValueExpression; - -/** - * Wrapper for providing context to ValueExpressions - * - * @author Jacob Hookom - */ -public final class JspValueExpression extends ValueExpression implements - Externalizable { - - private ValueExpression target; - - private String mark; - - public JspValueExpression() { - super(); - } - - public JspValueExpression(String mark, ValueExpression target) { - this.target = target; - this.mark = mark; - } - - public Class getExpectedType() { - return this.target.getExpectedType(); - } - - public Class getType(ELContext context) throws NullPointerException, - PropertyNotFoundException, ELException { - try { - return this.target.getType(context); - } catch (PropertyNotFoundException e) { - if (e instanceof JspPropertyNotFoundException) throw e; - throw new JspPropertyNotFoundException(this.mark, e); - } catch (ELException e) { - if (e instanceof JspELException) throw e; - throw new JspELException(this.mark, e); - } - } - - public boolean isReadOnly(ELContext context) throws NullPointerException, - PropertyNotFoundException, ELException { - try { - return this.target.isReadOnly(context); - } catch (PropertyNotFoundException e) { - if (e instanceof JspPropertyNotFoundException) throw e; - throw new JspPropertyNotFoundException(this.mark, e); - } catch (ELException e) { - if (e instanceof JspELException) throw e; - throw new JspELException(this.mark, e); - } - } - - public void setValue(ELContext context, Object value) - throws NullPointerException, PropertyNotFoundException, - PropertyNotWritableException, ELException { - try { - this.target.setValue(context, value); - } catch (PropertyNotWritableException e) { - if (e instanceof JspPropertyNotWritableException) throw e; - throw new JspPropertyNotWritableException(this.mark, e); - } catch (PropertyNotFoundException e) { - if (e instanceof JspPropertyNotFoundException) throw e; - throw new JspPropertyNotFoundException(this.mark, e); - } catch (ELException e) { - if (e instanceof JspELException) throw e; - throw new JspELException(this.mark, e); - } - } - - public Object getValue(ELContext context) throws NullPointerException, - PropertyNotFoundException, ELException { - try { - return this.target.getValue(context); - } catch (PropertyNotFoundException e) { - if (e instanceof JspPropertyNotFoundException) throw e; - throw new JspPropertyNotFoundException(this.mark, e); - } catch (ELException e) { - if (e instanceof JspELException) throw e; - throw new JspELException(this.mark, e); - } - } - - public boolean equals(Object obj) { - return this.target.equals(obj); - } - - public int hashCode() { - return this.target.hashCode(); - } - - public String getExpressionString() { - return this.target.getExpressionString(); - } - - public boolean isLiteralText() { - return this.target.isLiteralText(); - } - - public void writeExternal(ObjectOutput out) throws IOException { - out.writeUTF(this.mark); - out.writeObject(this.target); - } - - public void readExternal(ObjectInput in) throws IOException, - ClassNotFoundException { - this.mark = in.readUTF(); - this.target = (ValueExpression) in.readObject(); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/VariableResolverImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/VariableResolverImpl.java deleted file mode 100644 index 7808e0f5e..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/el/VariableResolverImpl.java +++ /dev/null @@ -1,35 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.el; - -import javax.el.ELContext; -import javax.servlet.jsp.el.ELException; -import javax.servlet.jsp.el.VariableResolver; - -public final class VariableResolverImpl implements VariableResolver { - - private final ELContext ctx; - - public VariableResolverImpl(ELContext ctx) { - this.ctx = ctx; - } - - public Object resolveVariable(String pName) throws ELException { - return this.ctx.getELResolver().getValue(this.ctx, null, pName); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/AnnotationHelper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/AnnotationHelper.java deleted file mode 100644 index 671945b26..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/AnnotationHelper.java +++ /dev/null @@ -1,61 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.lang.reflect.InvocationTargetException; - -import javax.naming.NamingException; - -import org.apache.AnnotationProcessor; - - -/** - * Verify the annotation and Process it. - * - * @author Fabien Carrion - * @author Remy Maucherat - * @version $Revision: 467222 $, $Date: 2006-10-24 05:17:11 +0200 (Tue, 24 Oct 2006) $ - */ -public class AnnotationHelper { - - - /** - * Call postConstruct method on the specified instance. Note: In Jasper, this - * calls naming resources injection as well. - */ - public static void postConstruct(AnnotationProcessor processor, Object instance) - throws IllegalAccessException, InvocationTargetException, NamingException { - if (processor != null) { - processor.processAnnotations(instance); - processor.postConstruct(instance); - } - } - - - /** - * Call preDestroy method on the specified instance. - */ - public static void preDestroy(AnnotationProcessor processor, Object instance) - throws IllegalAccessException, InvocationTargetException { - if (processor != null) { - processor.preDestroy(instance); - } - } - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/BodyContentImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/BodyContentImpl.java deleted file mode 100644 index 1c2a8e797..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/BodyContentImpl.java +++ /dev/null @@ -1,604 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.io.CharArrayReader; -import java.io.IOException; -import java.io.Reader; -import java.io.Writer; - -import javax.servlet.jsp.JspWriter; -import javax.servlet.jsp.tagext.BodyContent; - -import org.apache.jasper.Constants; - -/** - * Write text to a character-output stream, buffering characters so as - * to provide for the efficient writing of single characters, arrays, - * and strings. - * - * Provide support for discarding for the output that has been buffered. - * - * @author Rajiv Mordani - * @author Jan Luehe - */ -public class BodyContentImpl extends BodyContent { - - private static final String LINE_SEPARATOR = - System.getProperty("line.separator"); - private static final boolean LIMIT_BUFFER = - Boolean.valueOf(System.getProperty("org.apache.jasper.runtime.BodyContentImpl.LIMIT_BUFFER", "false")).booleanValue(); - - private char[] cb; - private int nextChar; - private boolean closed; - - // Enclosed writer to which any output is written - private Writer writer; - - /** - * Constructor. - */ - public BodyContentImpl(JspWriter enclosingWriter) { - super(enclosingWriter); - bufferSize = Constants.DEFAULT_TAG_BUFFER_SIZE; - cb = new char[bufferSize]; - nextChar = 0; - closed = false; - } - - /** - * Write a single character. - */ - public void write(int c) throws IOException { - if (writer != null) { - writer.write(c); - } else { - ensureOpen(); - if (nextChar >= bufferSize) { - reAllocBuff (1); - } - cb[nextChar++] = (char) c; - } - } - - /** - * Write a portion of an array of characters. - * - *

Ordinarily this method stores characters from the given array into - * this stream's buffer, flushing the buffer to the underlying stream as - * needed. If the requested length is at least as large as the buffer, - * however, then this method will flush the buffer and write the characters - * directly to the underlying stream. Thus redundant - * DiscardableBufferedWriters will not copy data - * unnecessarily. - * - * @param cbuf A character array - * @param off Offset from which to start reading characters - * @param len Number of characters to write - */ - public void write(char[] cbuf, int off, int len) throws IOException { - if (writer != null) { - writer.write(cbuf, off, len); - } else { - ensureOpen(); - - if ((off < 0) || (off > cbuf.length) || (len < 0) || - ((off + len) > cbuf.length) || ((off + len) < 0)) { - throw new IndexOutOfBoundsException(); - } else if (len == 0) { - return; - } - - if (len >= bufferSize - nextChar) - reAllocBuff (len); - - System.arraycopy(cbuf, off, cb, nextChar, len); - nextChar+=len; - } - } - - /** - * Write an array of characters. This method cannot be inherited from the - * Writer class because it must suppress I/O exceptions. - */ - public void write(char[] buf) throws IOException { - if (writer != null) { - writer.write(buf); - } else { - write(buf, 0, buf.length); - } - } - - /** - * Write a portion of a String. - * - * @param s String to be written - * @param off Offset from which to start reading characters - * @param len Number of characters to be written - */ - public void write(String s, int off, int len) throws IOException { - if (writer != null) { - writer.write(s, off, len); - } else { - ensureOpen(); - if (len >= bufferSize - nextChar) - reAllocBuff(len); - - s.getChars(off, off + len, cb, nextChar); - nextChar += len; - } - } - - /** - * Write a string. This method cannot be inherited from the Writer class - * because it must suppress I/O exceptions. - */ - public void write(String s) throws IOException { - if (writer != null) { - writer.write(s); - } else { - write(s, 0, s.length()); - } - } - - /** - * Write a line separator. The line separator string is defined by the - * system property line.separator, and is not necessarily a single - * newline ('\n') character. - * - * @throws IOException If an I/O error occurs - */ - public void newLine() throws IOException { - if (writer != null) { - writer.write(LINE_SEPARATOR); - } else { - write(LINE_SEPARATOR); - } - } - - /** - * Print a boolean value. The string produced by {@link - * java.lang.String#valueOf(boolean)} is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link - * #write(int)} method. - * - * @param b The boolean to be printed - * @throws IOException - */ - public void print(boolean b) throws IOException { - if (writer != null) { - writer.write(b ? "true" : "false"); - } else { - write(b ? "true" : "false"); - } - } - - /** - * Print a character. The character is translated into one or more bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link - * #write(int)} method. - * - * @param c The char to be printed - * @throws IOException - */ - public void print(char c) throws IOException { - if (writer != null) { - writer.write(String.valueOf(c)); - } else { - write(String.valueOf(c)); - } - } - - /** - * Print an integer. The string produced by {@link - * java.lang.String#valueOf(int)} is translated into bytes according - * to the platform's default character encoding, and these bytes are - * written in exactly the manner of the {@link #write(int)} - * method. - * - * @param i The int to be printed - * @throws IOException - */ - public void print(int i) throws IOException { - if (writer != null) { - writer.write(String.valueOf(i)); - } else { - write(String.valueOf(i)); - } - } - - /** - * Print a long integer. The string produced by {@link - * java.lang.String#valueOf(long)} is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the - * {@link #write(int)} method. - * - * @param l The long to be printed - * @throws IOException - */ - public void print(long l) throws IOException { - if (writer != null) { - writer.write(String.valueOf(l)); - } else { - write(String.valueOf(l)); - } - } - - /** - * Print a floating-point number. The string produced by {@link - * java.lang.String#valueOf(float)} is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the - * {@link #write(int)} method. - * - * @param f The float to be printed - * @throws IOException - */ - public void print(float f) throws IOException { - if (writer != null) { - writer.write(String.valueOf(f)); - } else { - write(String.valueOf(f)); - } - } - - /** - * Print a double-precision floating-point number. The string produced by - * {@link java.lang.String#valueOf(double)} is translated into - * bytes according to the platform's default character encoding, and these - * bytes are written in exactly the manner of the {@link - * #write(int)} method. - * - * @param d The double to be printed - * @throws IOException - */ - public void print(double d) throws IOException { - if (writer != null) { - writer.write(String.valueOf(d)); - } else { - write(String.valueOf(d)); - } - } - - /** - * Print an array of characters. The characters are converted into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the - * {@link #write(int)} method. - * - * @param s The array of chars to be printed - * - * @throws NullPointerException If s is null - * @throws IOException - */ - public void print(char[] s) throws IOException { - if (writer != null) { - writer.write(s); - } else { - write(s); - } - } - - /** - * Print a string. If the argument is null then the string - * "null" is printed. Otherwise, the string's characters are - * converted into bytes according to the platform's default character - * encoding, and these bytes are written in exactly the manner of the - * {@link #write(int)} method. - * - * @param s The String to be printed - * @throws IOException - */ - public void print(String s) throws IOException { - if (s == null) s = "null"; - if (writer != null) { - writer.write(s); - } else { - write(s); - } - } - - /** - * Print an object. The string produced by the {@link - * java.lang.String#valueOf(Object)} method is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the - * {@link #write(int)} method. - * - * @param obj The Object to be printed - * @throws IOException - */ - public void print(Object obj) throws IOException { - if (writer != null) { - writer.write(String.valueOf(obj)); - } else { - write(String.valueOf(obj)); - } - } - - /** - * Terminate the current line by writing the line separator string. The - * line separator string is defined by the system property - * line.separator, and is not necessarily a single newline - * character ('\n'). - * - * @throws IOException - */ - public void println() throws IOException { - newLine(); - } - - /** - * Print a boolean value and then terminate the line. This method behaves - * as though it invokes {@link #print(boolean)} and then - * {@link #println()}. - * - * @throws IOException - */ - public void println(boolean x) throws IOException { - print(x); - println(); - } - - /** - * Print a character and then terminate the line. This method behaves as - * though it invokes {@link #print(char)} and then - * {@link #println()}. - * - * @throws IOException - */ - public void println(char x) throws IOException { - print(x); - println(); - } - - /** - * Print an integer and then terminate the line. This method behaves as - * though it invokes {@link #print(int)} and then - * {@link #println()}. - * - * @throws IOException - */ - public void println(int x) throws IOException { - print(x); - println(); - } - - /** - * Print a long integer and then terminate the line. This method behaves - * as though it invokes {@link #print(long)} and then - * {@link #println()}. - * - * @throws IOException - */ - public void println(long x) throws IOException { - print(x); - println(); - } - - /** - * Print a floating-point number and then terminate the line. This method - * behaves as though it invokes {@link #print(float)} and then - * {@link #println()}. - * - * @throws IOException - */ - public void println(float x) throws IOException { - print(x); - println(); - } - - /** - * Print a double-precision floating-point number and then terminate the - * line. This method behaves as though it invokes {@link - * #print(double)} and then {@link #println()}. - * - * @throws IOException - */ - public void println(double x) throws IOException{ - print(x); - println(); - } - - /** - * Print an array of characters and then terminate the line. This method - * behaves as though it invokes {@link #print(char[])} and - * then {@link #println()}. - * - * @throws IOException - */ - public void println(char x[]) throws IOException { - print(x); - println(); - } - - /** - * Print a String and then terminate the line. This method behaves as - * though it invokes {@link #print(String)} and then - * {@link #println()}. - * - * @throws IOException - */ - public void println(String x) throws IOException { - print(x); - println(); - } - - /** - * Print an Object and then terminate the line. This method behaves as - * though it invokes {@link #print(Object)} and then - * {@link #println()}. - * - * @throws IOException - */ - public void println(Object x) throws IOException { - print(x); - println(); - } - - /** - * Clear the contents of the buffer. If the buffer has been already - * been flushed then the clear operation shall throw an IOException - * to signal the fact that some data has already been irrevocably - * written to the client response stream. - * - * @throws IOException If an I/O error occurs - */ - public void clear() throws IOException { - if (writer != null) { - throw new IOException(); - } else { - nextChar = 0; - if (LIMIT_BUFFER && (cb.length > Constants.DEFAULT_TAG_BUFFER_SIZE)) { - bufferSize = Constants.DEFAULT_TAG_BUFFER_SIZE; - cb = new char[bufferSize]; - } - } - } - - /** - * Clears the current contents of the buffer. Unlike clear(), this - * mehtod will not throw an IOException if the buffer has already been - * flushed. It merely clears the current content of the buffer and - * returns. - * - * @throws IOException If an I/O error occurs - */ - public void clearBuffer() throws IOException { - if (writer == null) { - this.clear(); - } - } - - /** - * Close the stream, flushing it first. Once a stream has been closed, - * further write() or flush() invocations will cause an IOException to be - * thrown. Closing a previously-closed stream, however, has no effect. - * - * @throws IOException If an I/O error occurs - */ - public void close() throws IOException { - if (writer != null) { - writer.close(); - } else { - closed = true; - } - } - - /** - * This method returns the size of the buffer used by the JspWriter. - * - * @return the size of the buffer in bytes, or 0 is unbuffered. - */ - public int getBufferSize() { - // According to the spec, the JspWriter returned by - // JspContext.pushBody(java.io.Writer writer) must behave as - // though it were unbuffered. This means that its getBufferSize() - // must always return 0. - return (writer == null) ? bufferSize : 0; - } - - /** - * @return the number of bytes unused in the buffer - */ - public int getRemaining() { - return (writer == null) ? bufferSize-nextChar : 0; - } - - /** - * Return the value of this BodyJspWriter as a Reader. - * Note: this is after evaluation!! There are no scriptlets, - * etc in this stream. - * - * @return the value of this BodyJspWriter as a Reader - */ - public Reader getReader() { - return (writer == null) ? new CharArrayReader (cb, 0, nextChar) : null; - } - - /** - * Return the value of the BodyJspWriter as a String. - * Note: this is after evaluation!! There are no scriptlets, - * etc in this stream. - * - * @return the value of the BodyJspWriter as a String - */ - public String getString() { - return (writer == null) ? new String(cb, 0, nextChar) : null; - } - - /** - * Write the contents of this BodyJspWriter into a Writer. - * Subclasses are likely to do interesting things with the - * implementation so some things are extra efficient. - * - * @param out The writer into which to place the contents of this body - * evaluation - */ - public void writeOut(Writer out) throws IOException { - if (writer == null) { - out.write(cb, 0, nextChar); - // Flush not called as the writer passed could be a BodyContent and - // it doesn't allow to flush. - } - } - - /** - * Sets the writer to which all output is written. - */ - void setWriter(Writer writer) { - this.writer = writer; - closed = false; - if (writer == null) { - clearBody(); - } - } - - private void ensureOpen() throws IOException { - if (closed) throw new IOException("Stream closed"); - } - - /** - * Reallocates buffer since the spec requires it to be unbounded. - */ - private void reAllocBuff(int len) { - - if (bufferSize + len <= cb.length) { - bufferSize = cb.length; - return; - } - - if (len < cb.length) { - len = cb.length; - } - - bufferSize = cb.length + len; - char[] tmp = new char[bufferSize]; - - System.arraycopy(cb, 0, tmp, 0, cb.length); - cb = tmp; - tmp = null; - - } - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/HttpJspBase.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/HttpJspBase.java deleted file mode 100644 index a1b6413aa..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/HttpJspBase.java +++ /dev/null @@ -1,88 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.io.IOException; - -import javax.servlet.ServletConfig; -import javax.servlet.ServletException; -import javax.servlet.http.HttpServlet; -import javax.servlet.http.HttpServletRequest; -import javax.servlet.http.HttpServletResponse; -import javax.servlet.jsp.HttpJspPage; -import javax.servlet.jsp.JspFactory; - -import org.apache.jasper.compiler.Localizer; - -/** - * This is the super class of all JSP-generated servlets. - * - * @author Anil K. Vijendran - */ -public abstract class HttpJspBase - extends HttpServlet - implements HttpJspPage - - -{ - - protected HttpJspBase() { - } - - public final void init(ServletConfig config) - throws ServletException - { - super.init(config); - jspInit(); - _jspInit(); - } - - public String getServletInfo() { - return Localizer.getMessage("jsp.engine.info"); - } - - public final void destroy() { - jspDestroy(); - _jspDestroy(); - } - - /** - * Entry point into service. - */ - public final void service(HttpServletRequest request, HttpServletResponse response) - throws ServletException, IOException - { - _jspService(request, response); - } - - public void jspInit() { - } - - public void _jspInit() { - } - - public void jspDestroy() { - } - - protected void _jspDestroy() { - } - - public abstract void _jspService(HttpServletRequest request, - HttpServletResponse response) - throws ServletException, IOException; -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspApplicationContextImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspApplicationContextImpl.java deleted file mode 100644 index 1ea649aa6..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspApplicationContextImpl.java +++ /dev/null @@ -1,138 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.runtime; - -import java.util.ArrayList; -import java.util.Iterator; -import java.util.List; - -import javax.el.ArrayELResolver; -import javax.el.BeanELResolver; -import javax.el.CompositeELResolver; -import javax.el.ELContextEvent; -import javax.el.ELContextListener; -import javax.el.ELResolver; -import javax.el.ExpressionFactory; -import javax.el.ListELResolver; -import javax.el.MapELResolver; -import javax.el.ResourceBundleELResolver; -import javax.servlet.ServletContext; -import javax.servlet.jsp.JspApplicationContext; -import javax.servlet.jsp.JspContext; -import javax.servlet.jsp.el.ImplicitObjectELResolver; -import javax.servlet.jsp.el.ScopedAttributeELResolver; - -import org.apache.el.ExpressionFactoryImpl; -import org.apache.jasper.el.ELContextImpl; - -/** - * Implementation of JspApplicationContext - * - * @author Jacob Hookom - */ -public class JspApplicationContextImpl implements JspApplicationContext { - - private final static String KEY = JspApplicationContextImpl.class.getName(); - - private final static ExpressionFactory expressionFactory = new ExpressionFactoryImpl(); - - private final List contextListeners = new ArrayList(); - - private final List resolvers = new ArrayList(); - - private boolean instantiated = false; - - private ELResolver resolver; - - public JspApplicationContextImpl() { - - } - - public void addELContextListener(ELContextListener listener) { - if (listener == null) { - throw new IllegalArgumentException("ELConextListener was null"); - } - this.contextListeners.add(listener); - } - - public static JspApplicationContextImpl getInstance(ServletContext context) { - if (context == null) { - throw new IllegalArgumentException("ServletContext was null"); - } - JspApplicationContextImpl impl = (JspApplicationContextImpl) context - .getAttribute(KEY); - if (impl == null) { - impl = new JspApplicationContextImpl(); - context.setAttribute(KEY, impl); - } - return impl; - } - - public ELContextImpl createELContext(JspContext context) { - if (context == null) { - throw new IllegalArgumentException("JspContext was null"); - } - - // create ELContext for JspContext - ELResolver r = this.createELResolver(); - ELContextImpl ctx = new ELContextImpl(r); - ctx.putContext(JspContext.class, context); - - // alert all ELContextListeners - ELContextEvent event = new ELContextEvent(ctx); - for (int i = 0; i < this.contextListeners.size(); i++) { - this.contextListeners.get(i).contextCreated(event); - } - - return ctx; - } - - private ELResolver createELResolver() { - this.instantiated = true; - if (this.resolver == null) { - CompositeELResolver r = new CompositeELResolver(); - r.add(new ImplicitObjectELResolver()); - for (Iterator itr = this.resolvers.iterator(); itr.hasNext();) { - r.add((ELResolver) itr.next()); - } - r.add(new MapELResolver()); - r.add(new ResourceBundleELResolver()); - r.add(new ListELResolver()); - r.add(new ArrayELResolver()); - r.add(new BeanELResolver()); - r.add(new ScopedAttributeELResolver()); - this.resolver = r; - } - return this.resolver; - } - - public void addELResolver(ELResolver resolver) throws IllegalStateException { - if (resolver == null) { - throw new IllegalArgumentException("ELResolver was null"); - } - if (this.instantiated) { - throw new IllegalStateException( - "cannot call addELResolver after the first request has been made"); - } - this.resolvers.add(resolver); - } - - public ExpressionFactory getExpressionFactory() { - return expressionFactory; - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspContextWrapper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspContextWrapper.java deleted file mode 100644 index 05f663836..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspContextWrapper.java +++ /dev/null @@ -1,462 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.io.IOException; -import java.io.Writer; -import java.util.ArrayList; -import java.util.Enumeration; -import java.util.HashMap; -import java.util.Iterator; -import java.util.Map; - -import javax.el.ELContext; -import javax.servlet.Servlet; -import javax.servlet.ServletConfig; -import javax.servlet.ServletContext; -import javax.servlet.ServletException; -import javax.servlet.ServletRequest; -import javax.servlet.ServletResponse; -import javax.servlet.http.HttpSession; -import javax.servlet.jsp.JspContext; -import javax.servlet.jsp.JspWriter; -import javax.servlet.jsp.PageContext; -import javax.servlet.jsp.el.ELException; -import javax.servlet.jsp.el.ExpressionEvaluator; -import javax.servlet.jsp.el.VariableResolver; -import javax.servlet.jsp.tagext.BodyContent; -import javax.servlet.jsp.tagext.VariableInfo; - -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.util.Enumerator; - -/** - * Implementation of a JSP Context Wrapper. - * - * The JSP Context Wrapper is a JspContext created and maintained by a tag - * handler implementation. It wraps the Invoking JSP Context, that is, the - * JspContext instance passed to the tag handler by the invoking page via - * setJspContext(). - * - * @author Kin-man Chung - * @author Jan Luehe - * @author Jacob Hookom - */ -public class JspContextWrapper extends PageContext implements VariableResolver { - - // Invoking JSP context - private PageContext invokingJspCtxt; - - private transient HashMap pageAttributes; - - // ArrayList of NESTED scripting variables - private ArrayList nestedVars; - - // ArrayList of AT_BEGIN scripting variables - private ArrayList atBeginVars; - - // ArrayList of AT_END scripting variables - private ArrayList atEndVars; - - private Map aliases; - - private HashMap originalNestedVars; - - public JspContextWrapper(JspContext jspContext, ArrayList nestedVars, - ArrayList atBeginVars, ArrayList atEndVars, Map aliases) { - this.invokingJspCtxt = (PageContext) jspContext; - this.nestedVars = nestedVars; - this.atBeginVars = atBeginVars; - this.atEndVars = atEndVars; - this.pageAttributes = new HashMap(16); - this.aliases = aliases; - - if (nestedVars != null) { - this.originalNestedVars = new HashMap(nestedVars.size()); - } - syncBeginTagFile(); - } - - public void initialize(Servlet servlet, ServletRequest request, - ServletResponse response, String errorPageURL, - boolean needsSession, int bufferSize, boolean autoFlush) - throws IOException, IllegalStateException, IllegalArgumentException { - } - - public Object getAttribute(String name) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - return pageAttributes.get(name); - } - - public Object getAttribute(String name, int scope) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (scope == PAGE_SCOPE) { - return pageAttributes.get(name); - } - - return invokingJspCtxt.getAttribute(name, scope); - } - - public void setAttribute(String name, Object value) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (value != null) { - pageAttributes.put(name, value); - } else { - removeAttribute(name, PAGE_SCOPE); - } - } - - public void setAttribute(String name, Object value, int scope) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (scope == PAGE_SCOPE) { - if (value != null) { - pageAttributes.put(name, value); - } else { - removeAttribute(name, PAGE_SCOPE); - } - } else { - invokingJspCtxt.setAttribute(name, value, scope); - } - } - - public Object findAttribute(String name) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - Object o = pageAttributes.get(name); - if (o == null) { - o = invokingJspCtxt.getAttribute(name, REQUEST_SCOPE); - if (o == null) { - if (getSession() != null) { - o = invokingJspCtxt.getAttribute(name, SESSION_SCOPE); - } - if (o == null) { - o = invokingJspCtxt.getAttribute(name, APPLICATION_SCOPE); - } - } - } - - return o; - } - - public void removeAttribute(String name) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - pageAttributes.remove(name); - invokingJspCtxt.removeAttribute(name, REQUEST_SCOPE); - if (getSession() != null) { - invokingJspCtxt.removeAttribute(name, SESSION_SCOPE); - } - invokingJspCtxt.removeAttribute(name, APPLICATION_SCOPE); - } - - public void removeAttribute(String name, int scope) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (scope == PAGE_SCOPE) { - pageAttributes.remove(name); - } else { - invokingJspCtxt.removeAttribute(name, scope); - } - } - - public int getAttributesScope(String name) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (pageAttributes.get(name) != null) { - return PAGE_SCOPE; - } else { - return invokingJspCtxt.getAttributesScope(name); - } - } - - public Enumeration getAttributeNamesInScope(int scope) { - if (scope == PAGE_SCOPE) { - return new Enumerator(pageAttributes.keySet().iterator()); - } - - return invokingJspCtxt.getAttributeNamesInScope(scope); - } - - public void release() { - invokingJspCtxt.release(); - } - - public JspWriter getOut() { - return invokingJspCtxt.getOut(); - } - - public HttpSession getSession() { - return invokingJspCtxt.getSession(); - } - - public Object getPage() { - return invokingJspCtxt.getPage(); - } - - public ServletRequest getRequest() { - return invokingJspCtxt.getRequest(); - } - - public ServletResponse getResponse() { - return invokingJspCtxt.getResponse(); - } - - public Exception getException() { - return invokingJspCtxt.getException(); - } - - public ServletConfig getServletConfig() { - return invokingJspCtxt.getServletConfig(); - } - - public ServletContext getServletContext() { - return invokingJspCtxt.getServletContext(); - } - - public void forward(String relativeUrlPath) throws ServletException, - IOException { - invokingJspCtxt.forward(relativeUrlPath); - } - - public void include(String relativeUrlPath) throws ServletException, - IOException { - invokingJspCtxt.include(relativeUrlPath); - } - - public void include(String relativeUrlPath, boolean flush) - throws ServletException, IOException { - invokingJspCtxt.include(relativeUrlPath, false); - } - - public VariableResolver getVariableResolver() { - return this; - } - - public BodyContent pushBody() { - return invokingJspCtxt.pushBody(); - } - - public JspWriter pushBody(Writer writer) { - return invokingJspCtxt.pushBody(writer); - } - - public JspWriter popBody() { - return invokingJspCtxt.popBody(); - } - - public ExpressionEvaluator getExpressionEvaluator() { - return invokingJspCtxt.getExpressionEvaluator(); - } - - public void handlePageException(Exception ex) throws IOException, - ServletException { - // Should never be called since handleException() called with a - // Throwable in the generated servlet. - handlePageException((Throwable) ex); - } - - public void handlePageException(Throwable t) throws IOException, - ServletException { - invokingJspCtxt.handlePageException(t); - } - - /** - * VariableResolver interface - */ - public Object resolveVariable(String pName) throws ELException { - ELContext ctx = this.getELContext(); - return ctx.getELResolver().getValue(ctx, null, pName); - } - - /** - * Synchronize variables at begin of tag file - */ - public void syncBeginTagFile() { - saveNestedVariables(); - } - - /** - * Synchronize variables before fragment invokation - */ - public void syncBeforeInvoke() { - copyTagToPageScope(VariableInfo.NESTED); - copyTagToPageScope(VariableInfo.AT_BEGIN); - } - - /** - * Synchronize variables at end of tag file - */ - public void syncEndTagFile() { - copyTagToPageScope(VariableInfo.AT_BEGIN); - copyTagToPageScope(VariableInfo.AT_END); - restoreNestedVariables(); - } - - /** - * Copies the variables of the given scope from the virtual page scope of - * this JSP context wrapper to the page scope of the invoking JSP context. - * - * @param scope - * variable scope (one of NESTED, AT_BEGIN, or AT_END) - */ - private void copyTagToPageScope(int scope) { - Iterator iter = null; - - switch (scope) { - case VariableInfo.NESTED: - if (nestedVars != null) { - iter = nestedVars.iterator(); - } - break; - case VariableInfo.AT_BEGIN: - if (atBeginVars != null) { - iter = atBeginVars.iterator(); - } - break; - case VariableInfo.AT_END: - if (atEndVars != null) { - iter = atEndVars.iterator(); - } - break; - } - - while ((iter != null) && iter.hasNext()) { - String varName = (String) iter.next(); - Object obj = getAttribute(varName); - varName = findAlias(varName); - if (obj != null) { - invokingJspCtxt.setAttribute(varName, obj); - } else { - invokingJspCtxt.removeAttribute(varName, PAGE_SCOPE); - } - } - } - - /** - * Saves the values of any NESTED variables that are present in the invoking - * JSP context, so they can later be restored. - */ - private void saveNestedVariables() { - if (nestedVars != null) { - Iterator iter = nestedVars.iterator(); - while (iter.hasNext()) { - String varName = (String) iter.next(); - varName = findAlias(varName); - Object obj = invokingJspCtxt.getAttribute(varName); - if (obj != null) { - originalNestedVars.put(varName, obj); - } - } - } - } - - /** - * Restores the values of any NESTED variables in the invoking JSP context. - */ - private void restoreNestedVariables() { - if (nestedVars != null) { - Iterator iter = nestedVars.iterator(); - while (iter.hasNext()) { - String varName = (String) iter.next(); - varName = findAlias(varName); - Object obj = originalNestedVars.get(varName); - if (obj != null) { - invokingJspCtxt.setAttribute(varName, obj); - } else { - invokingJspCtxt.removeAttribute(varName, PAGE_SCOPE); - } - } - } - } - - /** - * Checks to see if the given variable name is used as an alias, and if so, - * returns the variable name for which it is used as an alias. - * - * @param varName - * The variable name to check - * @return The variable name for which varName is used as an alias, or - * varName if it is not being used as an alias - */ - private String findAlias(String varName) { - - if (aliases == null) - return varName; - - String alias = (String) aliases.get(varName); - if (alias == null) { - return varName; - } - return alias; - } - - //private ELContextImpl elContext; - - public ELContext getELContext() { - // instead decorate!!! - - return this.invokingJspCtxt.getELContext(); - - /* - if (this.elContext != null) { - JspFactory jspFact = JspFactory.getDefaultFactory(); - ServletContext servletContext = this.getServletContext(); - JspApplicationContextImpl jspCtx = (JspApplicationContextImpl) jspFact - .getJspApplicationContext(servletContext); - this.elContext = jspCtx.createELContext(this); - } - return this.elContext; - */ - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspFactoryImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspFactoryImpl.java deleted file mode 100644 index f06a49d54..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspFactoryImpl.java +++ /dev/null @@ -1,202 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.runtime; - -import java.security.AccessController; -import java.security.PrivilegedAction; - -import javax.servlet.Servlet; -import javax.servlet.ServletContext; -import javax.servlet.ServletRequest; -import javax.servlet.ServletResponse; -import javax.servlet.jsp.JspApplicationContext; -import javax.servlet.jsp.JspEngineInfo; -import javax.servlet.jsp.JspFactory; -import javax.servlet.jsp.PageContext; - -import org.apache.jasper.Constants; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * Implementation of JspFactory. - * - * @author Anil K. Vijendran - */ -public class JspFactoryImpl extends JspFactory { - - // Logger - private Log log = LogFactory.getLog(JspFactoryImpl.class); - - private static final String SPEC_VERSION = "2.1"; - private static final boolean USE_POOL = - Boolean.valueOf(System.getProperty("org.apache.jasper.runtime.JspFactoryImpl.USE_POOL", "true")).booleanValue(); - private static final int POOL_SIZE = - Integer.valueOf(System.getProperty("org.apache.jasper.runtime.JspFactoryImpl.POOL_SIZE", "8")).intValue(); - - private ThreadLocal localPool = new ThreadLocal(); - - public PageContext getPageContext(Servlet servlet, ServletRequest request, - ServletResponse response, String errorPageURL, boolean needsSession, - int bufferSize, boolean autoflush) { - - if( Constants.IS_SECURITY_ENABLED ) { - PrivilegedGetPageContext dp = new PrivilegedGetPageContext( - (JspFactoryImpl)this, servlet, request, response, errorPageURL, - needsSession, bufferSize, autoflush); - return (PageContext)AccessController.doPrivileged(dp); - } else { - return internalGetPageContext(servlet, request, response, - errorPageURL, needsSession, - bufferSize, autoflush); - } - } - - public void releasePageContext(PageContext pc) { - if( pc == null ) - return; - if( Constants.IS_SECURITY_ENABLED ) { - PrivilegedReleasePageContext dp = new PrivilegedReleasePageContext( - (JspFactoryImpl)this,pc); - AccessController.doPrivileged(dp); - } else { - internalReleasePageContext(pc); - } - } - - public JspEngineInfo getEngineInfo() { - return new JspEngineInfo() { - public String getSpecificationVersion() { - return SPEC_VERSION; - } - }; - } - - private PageContext internalGetPageContext(Servlet servlet, ServletRequest request, - ServletResponse response, String errorPageURL, boolean needsSession, - int bufferSize, boolean autoflush) { - try { - PageContext pc; - if (USE_POOL) { - PageContextPool pool = localPool.get(); - if (pool == null) { - pool = new PageContextPool(); - localPool.set(pool); - } - pc = pool.get(); - if (pc == null) { - pc = new PageContextImpl(); - } - } else { - pc = new PageContextImpl(); - } - pc.initialize(servlet, request, response, errorPageURL, - needsSession, bufferSize, autoflush); - return pc; - } catch (Throwable ex) { - /* FIXME: need to do something reasonable here!! */ - log.fatal("Exception initializing page context", ex); - return null; - } - } - - private void internalReleasePageContext(PageContext pc) { - pc.release(); - if (USE_POOL && (pc instanceof PageContextImpl)) { - localPool.get().put(pc); - } - } - - private class PrivilegedGetPageContext implements PrivilegedAction { - - private JspFactoryImpl factory; - private Servlet servlet; - private ServletRequest request; - private ServletResponse response; - private String errorPageURL; - private boolean needsSession; - private int bufferSize; - private boolean autoflush; - - PrivilegedGetPageContext(JspFactoryImpl factory, Servlet servlet, - ServletRequest request, ServletResponse response, String errorPageURL, - boolean needsSession, int bufferSize, boolean autoflush) { - this.factory = factory; - this.servlet = servlet; - this.request = request; - this.response = response; - this.errorPageURL = errorPageURL; - this.needsSession = needsSession; - this.bufferSize = bufferSize; - this.autoflush = autoflush; - } - - public Object run() { - return factory.internalGetPageContext(servlet, request, response, - errorPageURL, needsSession, bufferSize, autoflush); - } - } - - private class PrivilegedReleasePageContext implements PrivilegedAction { - - private JspFactoryImpl factory; - private PageContext pageContext; - - PrivilegedReleasePageContext(JspFactoryImpl factory, - PageContext pageContext) { - this.factory = factory; - this.pageContext = pageContext; - } - - public Object run() { - factory.internalReleasePageContext(pageContext); - return null; - } - } - - protected final class PageContextPool { - - private PageContext[] pool; - - private int current = -1; - - public PageContextPool() { - this.pool = new PageContext[POOL_SIZE]; - } - - public void put(PageContext o) { - if (current < (POOL_SIZE - 1)) { - current++; - pool[current] = o; - } - } - - public PageContext get() { - PageContext item = null; - if (current >= 0) { - item = pool[current]; - current--; - } - return item; - } - - } - - public JspApplicationContext getJspApplicationContext(ServletContext context) { - return JspApplicationContextImpl.getInstance(context); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspFragmentHelper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspFragmentHelper.java deleted file mode 100644 index 38d26d34b..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspFragmentHelper.java +++ /dev/null @@ -1,65 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import javax.servlet.jsp.JspContext; -import javax.servlet.jsp.PageContext; -import javax.servlet.jsp.tagext.JspFragment; -import javax.servlet.jsp.tagext.JspTag; - -/** - * Helper class from which all Jsp Fragment helper classes extend. - * This class allows for the emulation of numerous fragments within - * a single class, which in turn reduces the load on the class loader - * since there are potentially many JspFragments in a single page. - *

- * The class also provides various utility methods for JspFragment - * implementations. - * - * @author Mark Roth - */ -public abstract class JspFragmentHelper - extends JspFragment -{ - - protected int discriminator; - protected JspContext jspContext; - protected PageContext _jspx_page_context; - protected JspTag parentTag; - - public JspFragmentHelper( int discriminator, JspContext jspContext, - JspTag parentTag ) - { - this.discriminator = discriminator; - this.jspContext = jspContext; - this._jspx_page_context = null; - if( jspContext instanceof PageContext ) { - _jspx_page_context = (PageContext)jspContext; - } - this.parentTag = parentTag; - } - - public JspContext getJspContext() { - return this.jspContext; - } - - public JspTag getParentTag() { - return this.parentTag; - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspRuntimeLibrary.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspRuntimeLibrary.java deleted file mode 100644 index 02d21ddf8..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspRuntimeLibrary.java +++ /dev/null @@ -1,1047 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.beans.PropertyEditor; -import java.beans.PropertyEditorManager; -import java.io.ByteArrayOutputStream; -import java.io.IOException; -import java.io.OutputStreamWriter; -import java.lang.reflect.Method; -import java.security.AccessController; -import java.security.PrivilegedActionException; -import java.security.PrivilegedExceptionAction; -import java.util.Enumeration; - -import javax.servlet.RequestDispatcher; -import javax.servlet.ServletException; -import javax.servlet.ServletRequest; -import javax.servlet.ServletResponse; -import javax.servlet.http.HttpServletRequest; -import javax.servlet.jsp.JspWriter; -import javax.servlet.jsp.PageContext; -import javax.servlet.jsp.tagext.BodyContent; - -import org.apache.jasper.Constants; -import org.apache.jasper.JasperException; -import org.apache.jasper.compiler.Localizer; - -/** - * Bunch of util methods that are used by code generated for useBean, - * getProperty and setProperty. - * - * The __begin, __end stuff is there so that the JSP engine can - * actually parse this file and inline them if people don't want - * runtime dependencies on this class. However, I'm not sure if that - * works so well right now. It got forgotten at some point. -akv - * - * @author Mandar Raje - * @author Shawn Bayern - */ -public class JspRuntimeLibrary { - - private static final String SERVLET_EXCEPTION - = "javax.servlet.error.exception"; - private static final String JSP_EXCEPTION - = "javax.servlet.jsp.jspException"; - - protected static class PrivilegedIntrospectHelper - implements PrivilegedExceptionAction { - - private Object bean; - private String prop; - private String value; - private ServletRequest request; - private String param; - private boolean ignoreMethodNF; - - PrivilegedIntrospectHelper(Object bean, String prop, - String value, ServletRequest request, - String param, boolean ignoreMethodNF) - { - this.bean = bean; - this.prop = prop; - this.value = value; - this.request = request; - this.param = param; - this.ignoreMethodNF = ignoreMethodNF; - } - - public Object run() throws JasperException { - internalIntrospecthelper( - bean,prop,value,request,param,ignoreMethodNF); - return null; - } - } - - /** - * Returns the value of the javax.servlet.error.exception request - * attribute value, if present, otherwise the value of the - * javax.servlet.jsp.jspException request attribute value. - * - * This method is called at the beginning of the generated servlet code - * for a JSP error page, when the "exception" implicit scripting language - * variable is initialized. - */ - public static Throwable getThrowable(ServletRequest request) { - Throwable error = (Throwable) request.getAttribute(SERVLET_EXCEPTION); - if (error == null) { - error = (Throwable) request.getAttribute(JSP_EXCEPTION); - if (error != null) { - /* - * The only place that sets JSP_EXCEPTION is - * PageContextImpl.handlePageException(). It really should set - * SERVLET_EXCEPTION, but that would interfere with the - * ErrorReportValve. Therefore, if JSP_EXCEPTION is set, we - * need to set SERVLET_EXCEPTION. - */ - request.setAttribute(SERVLET_EXCEPTION, error); - } - } - - return error; - } - - public static boolean coerceToBoolean(String s) { - if (s == null || s.length() == 0) - return false; - else - return Boolean.valueOf(s).booleanValue(); - } - - public static byte coerceToByte(String s) { - if (s == null || s.length() == 0) - return (byte) 0; - else - return Byte.valueOf(s).byteValue(); - } - - public static char coerceToChar(String s) { - if (s == null || s.length() == 0) { - return (char) 0; - } else { - // this trick avoids escaping issues - return (char)(int) s.charAt(0); - } - } - - public static double coerceToDouble(String s) { - if (s == null || s.length() == 0) - return (double) 0; - else - return Double.valueOf(s).doubleValue(); - } - - public static float coerceToFloat(String s) { - if (s == null || s.length() == 0) - return (float) 0; - else - return Float.valueOf(s).floatValue(); - } - - public static int coerceToInt(String s) { - if (s == null || s.length() == 0) - return 0; - else - return Integer.valueOf(s).intValue(); - } - - public static short coerceToShort(String s) { - if (s == null || s.length() == 0) - return (short) 0; - else - return Short.valueOf(s).shortValue(); - } - - public static long coerceToLong(String s) { - if (s == null || s.length() == 0) - return (long) 0; - else - return Long.valueOf(s).longValue(); - } - - public static Object coerce(String s, Class target) { - - boolean isNullOrEmpty = (s == null || s.length() == 0); - - if (target == Boolean.class) { - if (isNullOrEmpty) { - s = "false"; - } - return new Boolean(s); - } else if (target == Byte.class) { - if (isNullOrEmpty) - return new Byte((byte) 0); - else - return new Byte(s); - } else if (target == Character.class) { - if (isNullOrEmpty) - return new Character((char) 0); - else - return new Character(s.charAt(0)); - } else if (target == Double.class) { - if (isNullOrEmpty) - return new Double(0); - else - return new Double(s); - } else if (target == Float.class) { - if (isNullOrEmpty) - return new Float(0); - else - return new Float(s); - } else if (target == Integer.class) { - if (isNullOrEmpty) - return new Integer(0); - else - return new Integer(s); - } else if (target == Short.class) { - if (isNullOrEmpty) - return new Short((short) 0); - else - return new Short(s); - } else if (target == Long.class) { - if (isNullOrEmpty) - return new Long(0); - else - return new Long(s); - } else { - return null; - } - } - - // __begin convertMethod - public static Object convert(String propertyName, String s, Class t, - Class propertyEditorClass) - throws JasperException - { - try { - if (s == null) { - if (t.equals(Boolean.class) || t.equals(Boolean.TYPE)) - s = "false"; - else - return null; - } - if (propertyEditorClass != null) { - return getValueFromBeanInfoPropertyEditor( - t, propertyName, s, propertyEditorClass); - } else if ( t.equals(Boolean.class) || t.equals(Boolean.TYPE) ) { - if (s.equalsIgnoreCase("on") || s.equalsIgnoreCase("true")) - s = "true"; - else - s = "false"; - return new Boolean(s); - } else if ( t.equals(Byte.class) || t.equals(Byte.TYPE) ) { - return new Byte(s); - } else if (t.equals(Character.class) || t.equals(Character.TYPE)) { - return s.length() > 0 ? new Character(s.charAt(0)) : null; - } else if ( t.equals(Short.class) || t.equals(Short.TYPE) ) { - return new Short(s); - } else if ( t.equals(Integer.class) || t.equals(Integer.TYPE) ) { - return new Integer(s); - } else if ( t.equals(Float.class) || t.equals(Float.TYPE) ) { - return new Float(s); - } else if ( t.equals(Long.class) || t.equals(Long.TYPE) ) { - return new Long(s); - } else if ( t.equals(Double.class) || t.equals(Double.TYPE) ) { - return new Double(s); - } else if ( t.equals(String.class) ) { - return s; - } else if ( t.equals(java.io.File.class) ) { - return new java.io.File(s); - } else if (t.getName().equals("java.lang.Object")) { - return new Object[] {s}; - } else { - return getValueFromPropertyEditorManager( - t, propertyName, s); - } - } catch (Exception ex) { - throw new JasperException(ex); - } - } - // __end convertMethod - - // __begin introspectMethod - public static void introspect(Object bean, ServletRequest request) - throws JasperException - { - Enumeration e = request.getParameterNames(); - while ( e.hasMoreElements() ) { - String name = (String) e.nextElement(); - String value = request.getParameter(name); - introspecthelper(bean, name, value, request, name, true); - } - } - // __end introspectMethod - - // __begin introspecthelperMethod - public static void introspecthelper(Object bean, String prop, - String value, ServletRequest request, - String param, boolean ignoreMethodNF) - throws JasperException - { - if( Constants.IS_SECURITY_ENABLED ) { - try { - PrivilegedIntrospectHelper dp = - new PrivilegedIntrospectHelper( - bean,prop,value,request,param,ignoreMethodNF); - AccessController.doPrivileged(dp); - } catch( PrivilegedActionException pe) { - Exception e = pe.getException(); - throw (JasperException)e; - } - } else { - internalIntrospecthelper( - bean,prop,value,request,param,ignoreMethodNF); - } - } - - private static void internalIntrospecthelper(Object bean, String prop, - String value, ServletRequest request, - String param, boolean ignoreMethodNF) - throws JasperException - { - Method method = null; - Class type = null; - Class propertyEditorClass = null; - try { - java.beans.BeanInfo info - = java.beans.Introspector.getBeanInfo(bean.getClass()); - if ( info != null ) { - java.beans.PropertyDescriptor pd[] - = info.getPropertyDescriptors(); - for (int i = 0 ; i < pd.length ; i++) { - if ( pd[i].getName().equals(prop) ) { - method = pd[i].getWriteMethod(); - type = pd[i].getPropertyType(); - propertyEditorClass = pd[i].getPropertyEditorClass(); - break; - } - } - } - if ( method != null ) { - if (type.isArray()) { - if (request == null) { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.setproperty.noindexset")); - } - Class t = type.getComponentType(); - String[] values = request.getParameterValues(param); - //XXX Please check. - if(values == null) return; - if(t.equals(String.class)) { - method.invoke(bean, new Object[] { values }); - } else { - Object tmpval = null; - createTypedArray (prop, bean, method, values, t, - propertyEditorClass); - } - } else { - if(value == null || (param != null && value.equals(""))) return; - Object oval = convert(prop, value, type, propertyEditorClass); - if ( oval != null ) - method.invoke(bean, new Object[] { oval }); - } - } - } catch (Exception ex) { - throw new JasperException(ex); - } - if (!ignoreMethodNF && (method == null)) { - if (type == null) { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.noproperty", - prop, - bean.getClass().getName())); - } else { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.nomethod.setproperty", - prop, - type.getName(), - bean.getClass().getName())); - } - } - } - // __end introspecthelperMethod - - //------------------------------------------------------------------- - // functions to convert builtin Java data types to string. - //------------------------------------------------------------------- - // __begin toStringMethod - public static String toString(Object o) { - return String.valueOf(o); - } - - public static String toString(byte b) { - return new Byte(b).toString(); - } - - public static String toString(boolean b) { - return new Boolean(b).toString(); - } - - public static String toString(short s) { - return new Short(s).toString(); - } - - public static String toString(int i) { - return new Integer(i).toString(); - } - - public static String toString(float f) { - return new Float(f).toString(); - } - - public static String toString(long l) { - return new Long(l).toString(); - } - - public static String toString(double d) { - return new Double(d).toString(); - } - - public static String toString(char c) { - return new Character(c).toString(); - } - // __end toStringMethod - - - /** - * Create a typed array. - * This is a special case where params are passed through - * the request and the property is indexed. - */ - public static void createTypedArray(String propertyName, - Object bean, - Method method, - String[] values, - Class t, - Class propertyEditorClass) - throws JasperException { - - try { - if (propertyEditorClass != null) { - Object[] tmpval = new Integer[values.length]; - for (int i=0; i^()[]{}$\\\n"; - - for(int index=0; index= encoded.length()) - count = encoded.length(); - else - count += 2; - } else if (cur == '+') { - holdbuffer[bufcount++] = (byte) ' '; - } else { - holdbuffer[bufcount++] = (byte) cur; - } - } - // REVISIT -- remedy for Deprecated warning. - //return new String(holdbuffer,0,0,bufcount); - return new String(holdbuffer,0,bufcount); - } - - // __begin lookupReadMethodMethod - public static Object handleGetProperty(Object o, String prop) - throws JasperException { - if (o == null) { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.nullbean")); - } - Object value = null; - try { - Method method = getReadMethod(o.getClass(), prop); - value = method.invoke(o, (Object[]) null); - } catch (Exception ex) { - throw new JasperException (ex); - } - return value; - } - // __end lookupReadMethodMethod - - // handles with EL expression for 'value' attribute -/** Use proprietaryEvaluate - public static void handleSetPropertyExpression(Object bean, - String prop, String expression, PageContext pageContext, - VariableResolver variableResolver, FunctionMapper functionMapper ) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { - pageContext.getExpressionEvaluator().evaluate( - expression, - method.getParameterTypes()[0], - variableResolver, - functionMapper, - null ) - }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } -**/ - public static void handleSetPropertyExpression(Object bean, - String prop, String expression, PageContext pageContext, - ProtectedFunctionMapper functionMapper ) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { - PageContextImpl.proprietaryEvaluate( - expression, - method.getParameterTypes()[0], - pageContext, - functionMapper, - false ) - }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - Object value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { value }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - int value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Integer(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - short value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Short(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - long value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Long(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - double value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Double(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - float value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Float(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - char value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Character(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - byte value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Byte(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static void handleSetProperty(Object bean, String prop, - boolean value) - throws JasperException - { - try { - Method method = getWriteMethod(bean.getClass(), prop); - method.invoke(bean, new Object[] { new Boolean(value) }); - } catch (Exception ex) { - throw new JasperException(ex); - } - } - - public static Method getWriteMethod(Class beanClass, String prop) - throws JasperException { - Method method = null; - Class type = null; - try { - java.beans.BeanInfo info - = java.beans.Introspector.getBeanInfo(beanClass); - if ( info != null ) { - java.beans.PropertyDescriptor pd[] - = info.getPropertyDescriptors(); - for (int i = 0 ; i < pd.length ; i++) { - if ( pd[i].getName().equals(prop) ) { - method = pd[i].getWriteMethod(); - type = pd[i].getPropertyType(); - break; - } - } - } else { - // just in case introspection silently fails. - throw new JasperException( - Localizer.getMessage("jsp.error.beans.nobeaninfo", - beanClass.getName())); - } - } catch (Exception ex) { - throw new JasperException (ex); - } - if (method == null) { - if (type == null) { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.noproperty", - prop, - beanClass.getName())); - } else { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.nomethod.setproperty", - prop, - type.getName(), - beanClass.getName())); - } - } - return method; - } - - public static Method getReadMethod(Class beanClass, String prop) - throws JasperException { - - Method method = null; - Class type = null; - try { - java.beans.BeanInfo info - = java.beans.Introspector.getBeanInfo(beanClass); - if ( info != null ) { - java.beans.PropertyDescriptor pd[] - = info.getPropertyDescriptors(); - for (int i = 0 ; i < pd.length ; i++) { - if ( pd[i].getName().equals(prop) ) { - method = pd[i].getReadMethod(); - type = pd[i].getPropertyType(); - break; - } - } - } else { - // just in case introspection silently fails. - throw new JasperException( - Localizer.getMessage("jsp.error.beans.nobeaninfo", - beanClass.getName())); - } - } catch (Exception ex) { - throw new JasperException (ex); - } - if (method == null) { - if (type == null) { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.noproperty", prop, - beanClass.getName())); - } else { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.nomethod", prop, - beanClass.getName())); - } - } - - return method; - } - - //********************************************************************* - // PropertyEditor Support - - public static Object getValueFromBeanInfoPropertyEditor( - Class attrClass, String attrName, String attrValue, - Class propertyEditorClass) - throws JasperException - { - try { - PropertyEditor pe = (PropertyEditor)propertyEditorClass.newInstance(); - pe.setAsText(attrValue); - return pe.getValue(); - } catch (Exception ex) { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.property.conversion", - attrValue, attrClass.getName(), attrName, - ex.getMessage())); - } - } - - public static Object getValueFromPropertyEditorManager( - Class attrClass, String attrName, String attrValue) - throws JasperException - { - try { - PropertyEditor propEditor = - PropertyEditorManager.findEditor(attrClass); - if (propEditor != null) { - propEditor.setAsText(attrValue); - return propEditor.getValue(); - } else { - throw new IllegalArgumentException( - Localizer.getMessage("jsp.error.beans.propertyeditor.notregistered")); - } - } catch (IllegalArgumentException ex) { - throw new JasperException( - Localizer.getMessage("jsp.error.beans.property.conversion", - attrValue, attrClass.getName(), attrName, - ex.getMessage())); - } - } - - - // ************************************************************************ - // General Purpose Runtime Methods - // ************************************************************************ - - - /** - * Convert a possibly relative resource path into a context-relative - * resource path that starts with a '/'. - * - * @param request The servlet request we are processing - * @param relativePath The possibly relative resource path - */ - public static String getContextRelativePath(ServletRequest request, - String relativePath) { - - if (relativePath.startsWith("/")) - return (relativePath); - if (!(request instanceof HttpServletRequest)) - return (relativePath); - HttpServletRequest hrequest = (HttpServletRequest) request; - String uri = (String) - request.getAttribute("javax.servlet.include.servlet_path"); - if (uri != null) { - String pathInfo = (String) - request.getAttribute("javax.servlet.include.path_info"); - if (pathInfo == null) { - if (uri.lastIndexOf('/') >= 0) - uri = uri.substring(0, uri.lastIndexOf('/')); - } - } - else { - uri = hrequest.getServletPath(); - if (uri.lastIndexOf('/') >= 0) - uri = uri.substring(0, uri.lastIndexOf('/')); - } - return uri + '/' + relativePath; - - } - - - /** - * Perform a RequestDispatcher.include() operation, with optional flushing - * of the response beforehand. - * - * @param request The servlet request we are processing - * @param response The servlet response we are processing - * @param relativePath The relative path of the resource to be included - * @param out The Writer to whom we are currently writing - * @param flush Should we flush before the include is processed? - * - * @exception IOException if thrown by the included servlet - * @exception ServletException if thrown by the included servlet - */ - public static void include(ServletRequest request, - ServletResponse response, - String relativePath, - JspWriter out, - boolean flush) - throws IOException, ServletException { - - if (flush && !(out instanceof BodyContent)) - out.flush(); - - // FIXME - It is tempting to use request.getRequestDispatcher() to - // resolve a relative path directly, but Catalina currently does not - // take into account whether the caller is inside a RequestDispatcher - // include or not. Whether Catalina *should* take that into account - // is a spec issue currently under review. In the mean time, - // replicate Jasper's previous behavior - - String resourcePath = getContextRelativePath(request, relativePath); - RequestDispatcher rd = request.getRequestDispatcher(resourcePath); - - rd.include(request, - new ServletResponseWrapperInclude(response, out)); - - } - - /** - * URL encodes a string, based on the supplied character encoding. - * This performs the same function as java.next.URLEncode.encode - * in J2SDK1.4, and should be removed if the only platform supported - * is 1.4 or higher. - * @param s The String to be URL encoded. - * @param enc The character encoding - * @return The URL encoded String - */ - public static String URLEncode(String s, String enc) { - - if (s == null) { - return "null"; - } - - if (enc == null) { - enc = "ISO-8859-1"; // The default request encoding - } - - StringBuffer out = new StringBuffer(s.length()); - ByteArrayOutputStream buf = new ByteArrayOutputStream(); - OutputStreamWriter writer = null; - try { - writer = new OutputStreamWriter(buf, enc); - } catch (java.io.UnsupportedEncodingException ex) { - // Use the default encoding? - writer = new OutputStreamWriter(buf); - } - - for (int i = 0; i < s.length(); i++) { - int c = s.charAt(i); - if (c == ' ') { - out.append('+'); - } else if (isSafeChar(c)) { - out.append((char)c); - } else { - // convert to external encoding before hex conversion - try { - writer.write(c); - writer.flush(); - } catch(IOException e) { - buf.reset(); - continue; - } - byte[] ba = buf.toByteArray(); - for (int j = 0; j < ba.length; j++) { - out.append('%'); - // Converting each byte in the buffer - out.append(Character.forDigit((ba[j]>>4) & 0xf, 16)); - out.append(Character.forDigit(ba[j] & 0xf, 16)); - } - buf.reset(); - } - } - return out.toString(); - } - - private static boolean isSafeChar(int c) { - if (c >= 'a' && c <= 'z') { - return true; - } - if (c >= 'A' && c <= 'Z') { - return true; - } - if (c >= '0' && c <= '9') { - return true; - } - if (c == '-' || c == '_' || c == '.' || c == '!' || - c == '~' || c == '*' || c == '\'' || c == '(' || c == ')') { - return true; - } - return false; - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspSourceDependent.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspSourceDependent.java deleted file mode 100644 index 2ba9364a6..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspSourceDependent.java +++ /dev/null @@ -1,39 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -/** - * Interface for tracking the source files dependencies, for the purpose - * of compiling out of date pages. This is used for - * 1) files that are included by page directives - * 2) files that are included by include-prelude and include-coda in jsp:config - * 3) files that are tag files and referenced - * 4) TLDs referenced - */ - -public interface JspSourceDependent { - - /** - * Returns a list of files names that the current page has a source - * dependency on. - */ - // FIXME: Type used is Object due to very weird behavior - // with Eclipse JDT 3.1 in Java 5 mode - public Object getDependants(); - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspWriterImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspWriterImpl.java deleted file mode 100644 index cf7a44383..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/JspWriterImpl.java +++ /dev/null @@ -1,590 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.io.IOException; -import java.io.Writer; -import java.security.AccessController; -import java.security.PrivilegedAction; - -import javax.servlet.ServletResponse; -import javax.servlet.jsp.JspWriter; - -import org.apache.jasper.Constants; -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.security.SecurityUtil; - -/** - * Write text to a character-output stream, buffering characters so as - * to provide for the efficient writing of single characters, arrays, - * and strings. - * - * Provide support for discarding for the output that has been - * buffered. - * - * This needs revisiting when the buffering problems in the JSP spec - * are fixed -akv - * - * @author Anil K. Vijendran - */ -public class JspWriterImpl extends JspWriter { - - private Writer out; - private ServletResponse response; - private char cb[]; - private int nextChar; - private boolean flushed = false; - private boolean closed = false; - - public JspWriterImpl() { - super( Constants.DEFAULT_BUFFER_SIZE, true ); - } - - /** - * Create a buffered character-output stream that uses a default-sized - * output buffer. - * - * @param response A Servlet Response - */ - public JspWriterImpl(ServletResponse response) { - this(response, Constants.DEFAULT_BUFFER_SIZE, true); - } - - /** - * Create a new buffered character-output stream that uses an output - * buffer of the given size. - * - * @param response A Servlet Response - * @param sz Output-buffer size, a positive integer - * - * @exception IllegalArgumentException If sz is <= 0 - */ - public JspWriterImpl(ServletResponse response, int sz, - boolean autoFlush) { - super(sz, autoFlush); - if (sz < 0) - throw new IllegalArgumentException("Buffer size <= 0"); - this.response = response; - cb = sz == 0 ? null : new char[sz]; - nextChar = 0; - } - - void init( ServletResponse response, int sz, boolean autoFlush ) { - this.response= response; - if( sz > 0 && ( cb == null || sz > cb.length ) ) - cb=new char[sz]; - nextChar = 0; - this.autoFlush=autoFlush; - this.bufferSize=sz; - } - - /** Package-level access - */ - void recycle() { - flushed = false; - closed = false; - out = null; - nextChar = 0; - response = null; - } - - /** - * Flush the output buffer to the underlying character stream, without - * flushing the stream itself. This method is non-private only so that it - * may be invoked by PrintStream. - */ - protected final void flushBuffer() throws IOException { - if (bufferSize == 0) - return; - flushed = true; - ensureOpen(); - if (nextChar == 0) - return; - initOut(); - out.write(cb, 0, nextChar); - nextChar = 0; - } - - private void initOut() throws IOException { - if (out == null) { - out = response.getWriter(); - } - } - - private String getLocalizeMessage(final String message){ - if (SecurityUtil.isPackageProtectionEnabled()){ - return (String)AccessController.doPrivileged(new PrivilegedAction(){ - public Object run(){ - return Localizer.getMessage(message); - } - }); - } else { - return Localizer.getMessage(message); - } - } - - /** - * Discard the output buffer. - */ - public final void clear() throws IOException { - if ((bufferSize == 0) && (out != null)) - // clear() is illegal after any unbuffered output (JSP.5.5) - throw new IllegalStateException( - getLocalizeMessage("jsp.error.ise_on_clear")); - if (flushed) - throw new IOException( - getLocalizeMessage("jsp.error.attempt_to_clear_flushed_buffer")); - ensureOpen(); - nextChar = 0; - } - - public void clearBuffer() throws IOException { - if (bufferSize == 0) - throw new IllegalStateException( - getLocalizeMessage("jsp.error.ise_on_clear")); - ensureOpen(); - nextChar = 0; - } - - private final void bufferOverflow() throws IOException { - throw new IOException(getLocalizeMessage("jsp.error.overflow")); - } - - /** - * Flush the stream. - * - */ - public void flush() throws IOException { - flushBuffer(); - if (out != null) { - out.flush(); - } - } - - /** - * Close the stream. - * - */ - public void close() throws IOException { - if (response == null || closed) - // multiple calls to close is OK - return; - flush(); - if (out != null) - out.close(); - out = null; - closed = true; - } - - /** - * @return the number of bytes unused in the buffer - */ - public int getRemaining() { - return bufferSize - nextChar; - } - - /** check to make sure that the stream has not been closed */ - private void ensureOpen() throws IOException { - if (response == null || closed) - throw new IOException("Stream closed"); - } - - - /** - * Write a single character. - */ - public void write(int c) throws IOException { - ensureOpen(); - if (bufferSize == 0) { - initOut(); - out.write(c); - } - else { - if (nextChar >= bufferSize) - if (autoFlush) - flushBuffer(); - else - bufferOverflow(); - cb[nextChar++] = (char) c; - } - } - - /** - * Our own little min method, to avoid loading java.lang.Math if we've run - * out of file descriptors and we're trying to print a stack trace. - */ - private int min(int a, int b) { - if (a < b) return a; - return b; - } - - /** - * Write a portion of an array of characters. - * - *

Ordinarily this method stores characters from the given array into - * this stream's buffer, flushing the buffer to the underlying stream as - * needed. If the requested length is at least as large as the buffer, - * however, then this method will flush the buffer and write the characters - * directly to the underlying stream. Thus redundant - * DiscardableBufferedWriters will not copy data unnecessarily. - * - * @param cbuf A character array - * @param off Offset from which to start reading characters - * @param len Number of characters to write - */ - public void write(char cbuf[], int off, int len) - throws IOException - { - ensureOpen(); - - if (bufferSize == 0) { - initOut(); - out.write(cbuf, off, len); - return; - } - - if ((off < 0) || (off > cbuf.length) || (len < 0) || - ((off + len) > cbuf.length) || ((off + len) < 0)) { - throw new IndexOutOfBoundsException(); - } else if (len == 0) { - return; - } - - if (len >= bufferSize) { - /* If the request length exceeds the size of the output buffer, - flush the buffer and then write the data directly. In this - way buffered streams will cascade harmlessly. */ - if (autoFlush) - flushBuffer(); - else - bufferOverflow(); - initOut(); - out.write(cbuf, off, len); - return; - } - - int b = off, t = off + len; - while (b < t) { - int d = min(bufferSize - nextChar, t - b); - System.arraycopy(cbuf, b, cb, nextChar, d); - b += d; - nextChar += d; - if (nextChar >= bufferSize) - if (autoFlush) - flushBuffer(); - else - bufferOverflow(); - } - - } - - /** - * Write an array of characters. This method cannot be inherited from the - * Writer class because it must suppress I/O exceptions. - */ - public void write(char buf[]) throws IOException { - write(buf, 0, buf.length); - } - - /** - * Write a portion of a String. - * - * @param s String to be written - * @param off Offset from which to start reading characters - * @param len Number of characters to be written - */ - public void write(String s, int off, int len) throws IOException { - ensureOpen(); - if (bufferSize == 0) { - initOut(); - out.write(s, off, len); - return; - } - int b = off, t = off + len; - while (b < t) { - int d = min(bufferSize - nextChar, t - b); - s.getChars(b, b + d, cb, nextChar); - b += d; - nextChar += d; - if (nextChar >= bufferSize) - if (autoFlush) - flushBuffer(); - else - bufferOverflow(); - } - } - - /** - * Write a string. This method cannot be inherited from the Writer class - * because it must suppress I/O exceptions. - */ - public void write(String s) throws IOException { - // Simple fix for Bugzilla 35410 - // Calling the other write function so as to init the buffer anyways - if(s == null) { - write(s, 0, 0); - } else { - write(s, 0, s.length()); - } - } - - - static String lineSeparator = System.getProperty("line.separator"); - - /** - * Write a line separator. The line separator string is defined by the - * system property line.separator, and is not necessarily a single - * newline ('\n') character. - * - * @exception IOException If an I/O error occurs - */ - - public void newLine() throws IOException { - write(lineSeparator); - } - - - /* Methods that do not terminate lines */ - - /** - * Print a boolean value. The string produced by {@link - * java.lang.String#valueOf(boolean)} is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link - * #write(int)} method. - * - * @param b The boolean to be printed - */ - public void print(boolean b) throws IOException { - write(b ? "true" : "false"); - } - - /** - * Print a character. The character is translated into one or more bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link - * #write(int)} method. - * - * @param c The char to be printed - */ - public void print(char c) throws IOException { - write(String.valueOf(c)); - } - - /** - * Print an integer. The string produced by {@link - * java.lang.String#valueOf(int)} is translated into bytes according - * to the platform's default character encoding, and these bytes are - * written in exactly the manner of the {@link #write(int)} - * method. - * - * @param i The int to be printed - */ - public void print(int i) throws IOException { - write(String.valueOf(i)); - } - - /** - * Print a long integer. The string produced by {@link - * java.lang.String#valueOf(long)} is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link #write(int)} - * method. - * - * @param l The long to be printed - */ - public void print(long l) throws IOException { - write(String.valueOf(l)); - } - - /** - * Print a floating-point number. The string produced by {@link - * java.lang.String#valueOf(float)} is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link #write(int)} - * method. - * - * @param f The float to be printed - */ - public void print(float f) throws IOException { - write(String.valueOf(f)); - } - - /** - * Print a double-precision floating-point number. The string produced by - * {@link java.lang.String#valueOf(double)} is translated into - * bytes according to the platform's default character encoding, and these - * bytes are written in exactly the manner of the {@link - * #write(int)} method. - * - * @param d The double to be printed - */ - public void print(double d) throws IOException { - write(String.valueOf(d)); - } - - /** - * Print an array of characters. The characters are converted into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link #write(int)} - * method. - * - * @param s The array of chars to be printed - * - * @throws NullPointerException If s is null - */ - public void print(char s[]) throws IOException { - write(s); - } - - /** - * Print a string. If the argument is null then the string - * "null" is printed. Otherwise, the string's characters are - * converted into bytes according to the platform's default character - * encoding, and these bytes are written in exactly the manner of the - * {@link #write(int)} method. - * - * @param s The String to be printed - */ - public void print(String s) throws IOException { - if (s == null) { - s = "null"; - } - write(s); - } - - /** - * Print an object. The string produced by the {@link - * java.lang.String#valueOf(Object)} method is translated into bytes - * according to the platform's default character encoding, and these bytes - * are written in exactly the manner of the {@link #write(int)} - * method. - * - * @param obj The Object to be printed - */ - public void print(Object obj) throws IOException { - write(String.valueOf(obj)); - } - - /* Methods that do terminate lines */ - - /** - * Terminate the current line by writing the line separator string. The - * line separator string is defined by the system property - * line.separator, and is not necessarily a single newline - * character ('\n'). - * - * Need to change this from PrintWriter because the default - * println() writes to the sink directly instead of through the - * write method... - */ - public void println() throws IOException { - newLine(); - } - - /** - * Print a boolean value and then terminate the line. This method behaves - * as though it invokes {@link #print(boolean)} and then - * {@link #println()}. - */ - public void println(boolean x) throws IOException { - print(x); - println(); - } - - /** - * Print a character and then terminate the line. This method behaves as - * though it invokes {@link #print(char)} and then {@link - * #println()}. - */ - public void println(char x) throws IOException { - print(x); - println(); - } - - /** - * Print an integer and then terminate the line. This method behaves as - * though it invokes {@link #print(int)} and then {@link - * #println()}. - */ - public void println(int x) throws IOException { - print(x); - println(); - } - - /** - * Print a long integer and then terminate the line. This method behaves - * as though it invokes {@link #print(long)} and then - * {@link #println()}. - */ - public void println(long x) throws IOException { - print(x); - println(); - } - - /** - * Print a floating-point number and then terminate the line. This method - * behaves as though it invokes {@link #print(float)} and then - * {@link #println()}. - */ - public void println(float x) throws IOException { - print(x); - println(); - } - - /** - * Print a double-precision floating-point number and then terminate the - * line. This method behaves as though it invokes {@link - * #print(double)} and then {@link #println()}. - */ - public void println(double x) throws IOException { - print(x); - println(); - } - - /** - * Print an array of characters and then terminate the line. This method - * behaves as though it invokes {@link #print(char[])} and then - * {@link #println()}. - */ - public void println(char x[]) throws IOException { - print(x); - println(); - } - - /** - * Print a String and then terminate the line. This method behaves as - * though it invokes {@link #print(String)} and then - * {@link #println()}. - */ - public void println(String x) throws IOException { - print(x); - println(); - } - - /** - * Print an Object and then terminate the line. This method behaves as - * though it invokes {@link #print(Object)} and then - * {@link #println()}. - */ - public void println(Object x) throws IOException { - print(x); - println(); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/PageContextImpl.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/PageContextImpl.java deleted file mode 100644 index 4b71e8a37..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/PageContextImpl.java +++ /dev/null @@ -1,951 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.io.IOException; -import java.io.Writer; -import java.security.AccessController; -import java.security.PrivilegedAction; -import java.security.PrivilegedActionException; -import java.security.PrivilegedExceptionAction; -import java.util.Enumeration; -import java.util.HashMap; - -import javax.el.ELContext; -import javax.el.ExpressionFactory; -import javax.el.ValueExpression; -import javax.servlet.Servlet; -import javax.servlet.ServletConfig; -import javax.servlet.ServletContext; -import javax.servlet.ServletException; -import javax.servlet.ServletRequest; -import javax.servlet.ServletResponse; -import javax.servlet.http.HttpServletRequest; -import javax.servlet.http.HttpServletResponse; -import javax.servlet.http.HttpSession; -import javax.servlet.jsp.JspException; -import javax.servlet.jsp.JspFactory; -import javax.servlet.jsp.JspWriter; -import javax.servlet.jsp.PageContext; -import javax.servlet.jsp.el.ELException; -import javax.servlet.jsp.el.ExpressionEvaluator; -import javax.servlet.jsp.el.VariableResolver; -import javax.servlet.jsp.tagext.BodyContent; - -import org.apache.jasper.Constants; -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.el.ELContextImpl; -import org.apache.jasper.el.ExpressionEvaluatorImpl; -import org.apache.jasper.el.FunctionMapperImpl; -import org.apache.jasper.el.VariableResolverImpl; -import org.apache.jasper.security.SecurityUtil; -import org.apache.jasper.util.Enumerator; - -/** - * Implementation of the PageContext class from the JSP spec. Also doubles as a - * VariableResolver for the EL. - * - * @author Anil K. Vijendran - * @author Larry Cable - * @author Hans Bergsten - * @author Pierre Delisle - * @author Mark Roth - * @author Jan Luehe - * @author Jacob Hookom - */ -public class PageContextImpl extends PageContext { - - private static final JspFactory jspf = JspFactory.getDefaultFactory(); - - private BodyContentImpl[] outs; - - private int depth; - - // per-servlet state - private Servlet servlet; - - private ServletConfig config; - - private ServletContext context; - - private JspApplicationContextImpl applicationContext; - - private String errorPageURL; - - // page-scope attributes - private transient HashMap attributes; - - // per-request state - private transient ServletRequest request; - - private transient ServletResponse response; - - private transient HttpSession session; - - private transient ELContextImpl elContext; - - private boolean isIncluded; - - - // initial output stream - private transient JspWriter out; - - private transient JspWriterImpl baseOut; - - /* - * Constructor. - */ - PageContextImpl() { - this.outs = new BodyContentImpl[0]; - this.attributes = new HashMap(16); - this.depth = -1; - } - - public void initialize(Servlet servlet, ServletRequest request, - ServletResponse response, String errorPageURL, - boolean needsSession, int bufferSize, boolean autoFlush) - throws IOException { - - _initialize(servlet, request, response, errorPageURL, needsSession, - bufferSize, autoFlush); - } - - private void _initialize(Servlet servlet, ServletRequest request, - ServletResponse response, String errorPageURL, - boolean needsSession, int bufferSize, boolean autoFlush) - throws IOException { - - // initialize state - this.servlet = servlet; - this.config = servlet.getServletConfig(); - this.context = config.getServletContext(); - this.errorPageURL = errorPageURL; - this.request = request; - this.response = response; - - // initialize application context - this.applicationContext = JspApplicationContextImpl.getInstance(context); - - // Setup session (if required) - if (request instanceof HttpServletRequest && needsSession) - this.session = ((HttpServletRequest) request).getSession(); - if (needsSession && session == null) - throw new IllegalStateException( - "Page needs a session and none is available"); - - // initialize the initial out ... - depth = -1; - if (this.baseOut == null) { - this.baseOut = new JspWriterImpl(response, bufferSize, autoFlush); - } else { - this.baseOut.init(response, bufferSize, autoFlush); - } - this.out = baseOut; - - // register names/values as per spec - setAttribute(OUT, this.out); - setAttribute(REQUEST, request); - setAttribute(RESPONSE, response); - - if (session != null) - setAttribute(SESSION, session); - - setAttribute(PAGE, servlet); - setAttribute(CONFIG, config); - setAttribute(PAGECONTEXT, this); - setAttribute(APPLICATION, context); - - isIncluded = request.getAttribute("javax.servlet.include.servlet_path") != null; - } - - public void release() { - out = baseOut; - try { - if (isIncluded) { - ((JspWriterImpl) out).flushBuffer(); - // push it into the including jspWriter - } else { - // Old code: - // out.flush(); - // Do not flush the buffer even if we're not included (i.e. - // we are the main page. The servlet will flush it and close - // the stream. - ((JspWriterImpl) out).flushBuffer(); - } - } catch (IOException ex) { - IllegalStateException ise = new IllegalStateException(Localizer.getMessage("jsp.error.flush"), ex); - throw ise; - } finally { - servlet = null; - config = null; - context = null; - applicationContext = null; - elContext = null; - errorPageURL = null; - request = null; - response = null; - depth = -1; - baseOut.recycle(); - session = null; - attributes.clear(); - } - } - - public Object getAttribute(final String name) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (SecurityUtil.isPackageProtectionEnabled()) { - return AccessController.doPrivileged(new PrivilegedAction() { - public Object run() { - return doGetAttribute(name); - } - }); - } else { - return doGetAttribute(name); - } - - } - - private Object doGetAttribute(String name) { - return attributes.get(name); - } - - public Object getAttribute(final String name, final int scope) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (SecurityUtil.isPackageProtectionEnabled()) { - return AccessController.doPrivileged(new PrivilegedAction() { - public Object run() { - return doGetAttribute(name, scope); - } - }); - } else { - return doGetAttribute(name, scope); - } - - } - - private Object doGetAttribute(String name, int scope) { - switch (scope) { - case PAGE_SCOPE: - return attributes.get(name); - - case REQUEST_SCOPE: - return request.getAttribute(name); - - case SESSION_SCOPE: - if (session == null) { - throw new IllegalStateException(Localizer - .getMessage("jsp.error.page.noSession")); - } - return session.getAttribute(name); - - case APPLICATION_SCOPE: - return context.getAttribute(name); - - default: - throw new IllegalArgumentException("Invalid scope"); - } - } - - public void setAttribute(final String name, final Object attribute) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (SecurityUtil.isPackageProtectionEnabled()) { - AccessController.doPrivileged(new PrivilegedAction() { - public Object run() { - doSetAttribute(name, attribute); - return null; - } - }); - } else { - doSetAttribute(name, attribute); - } - } - - private void doSetAttribute(String name, Object attribute) { - if (attribute != null) { - attributes.put(name, attribute); - } else { - removeAttribute(name, PAGE_SCOPE); - } - } - - public void setAttribute(final String name, final Object o, final int scope) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (SecurityUtil.isPackageProtectionEnabled()) { - AccessController.doPrivileged(new PrivilegedAction() { - public Object run() { - doSetAttribute(name, o, scope); - return null; - } - }); - } else { - doSetAttribute(name, o, scope); - } - - } - - private void doSetAttribute(String name, Object o, int scope) { - if (o != null) { - switch (scope) { - case PAGE_SCOPE: - attributes.put(name, o); - break; - - case REQUEST_SCOPE: - request.setAttribute(name, o); - break; - - case SESSION_SCOPE: - if (session == null) { - throw new IllegalStateException(Localizer - .getMessage("jsp.error.page.noSession")); - } - session.setAttribute(name, o); - break; - - case APPLICATION_SCOPE: - context.setAttribute(name, o); - break; - - default: - throw new IllegalArgumentException("Invalid scope"); - } - } else { - removeAttribute(name, scope); - } - } - - public void removeAttribute(final String name, final int scope) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - if (SecurityUtil.isPackageProtectionEnabled()) { - AccessController.doPrivileged(new PrivilegedAction() { - public Object run() { - doRemoveAttribute(name, scope); - return null; - } - }); - } else { - doRemoveAttribute(name, scope); - } - } - - private void doRemoveAttribute(String name, int scope) { - switch (scope) { - case PAGE_SCOPE: - attributes.remove(name); - break; - - case REQUEST_SCOPE: - request.removeAttribute(name); - break; - - case SESSION_SCOPE: - if (session == null) { - throw new IllegalStateException(Localizer - .getMessage("jsp.error.page.noSession")); - } - session.removeAttribute(name); - break; - - case APPLICATION_SCOPE: - context.removeAttribute(name); - break; - - default: - throw new IllegalArgumentException("Invalid scope"); - } - } - - public int getAttributesScope(final String name) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (SecurityUtil.isPackageProtectionEnabled()) { - return ((Integer) AccessController - .doPrivileged(new PrivilegedAction() { - public Object run() { - return new Integer(doGetAttributeScope(name)); - } - })).intValue(); - } else { - return doGetAttributeScope(name); - } - } - - private int doGetAttributeScope(String name) { - if (attributes.get(name) != null) - return PAGE_SCOPE; - - if (request.getAttribute(name) != null) - return REQUEST_SCOPE; - - if (session != null) { - try { - if (session.getAttribute(name) != null) - return SESSION_SCOPE; - } catch(IllegalStateException ise) { - // Session has been invalidated. - // Ignore and fall through to application scope. - } - } - - if (context.getAttribute(name) != null) - return APPLICATION_SCOPE; - - return 0; - } - - public Object findAttribute(final String name) { - if (SecurityUtil.isPackageProtectionEnabled()) { - return AccessController.doPrivileged(new PrivilegedAction() { - public Object run() { - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - return doFindAttribute(name); - } - }); - } else { - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - return doFindAttribute(name); - } - } - - private Object doFindAttribute(String name) { - - Object o = attributes.get(name); - if (o != null) - return o; - - o = request.getAttribute(name); - if (o != null) - return o; - - if (session != null) { - try { - o = session.getAttribute(name); - } catch(IllegalStateException ise) { - // Session has been invalidated. - // Ignore and fall through to application scope. - } - if (o != null) - return o; - } - - return context.getAttribute(name); - } - - public Enumeration getAttributeNamesInScope(final int scope) { - if (SecurityUtil.isPackageProtectionEnabled()) { - return (Enumeration) AccessController - .doPrivileged(new PrivilegedAction() { - public Object run() { - return doGetAttributeNamesInScope(scope); - } - }); - } else { - return doGetAttributeNamesInScope(scope); - } - } - - private Enumeration doGetAttributeNamesInScope(int scope) { - switch (scope) { - case PAGE_SCOPE: - return new Enumerator(attributes.keySet().iterator()); - - case REQUEST_SCOPE: - return request.getAttributeNames(); - - case SESSION_SCOPE: - if (session == null) { - throw new IllegalStateException(Localizer - .getMessage("jsp.error.page.noSession")); - } - return session.getAttributeNames(); - - case APPLICATION_SCOPE: - return context.getAttributeNames(); - - default: - throw new IllegalArgumentException("Invalid scope"); - } - } - - public void removeAttribute(final String name) { - - if (name == null) { - throw new NullPointerException(Localizer - .getMessage("jsp.error.attribute.null_name")); - } - - if (SecurityUtil.isPackageProtectionEnabled()) { - AccessController.doPrivileged(new PrivilegedAction() { - public Object run() { - doRemoveAttribute(name); - return null; - } - }); - } else { - doRemoveAttribute(name); - } - } - - private void doRemoveAttribute(String name) { - removeAttribute(name, PAGE_SCOPE); - removeAttribute(name, REQUEST_SCOPE); - if( session != null ) { - try { - removeAttribute(name, SESSION_SCOPE); - } catch(IllegalStateException ise) { - // Session has been invalidated. - // Ignore and fall throw to application scope. - } - } - removeAttribute(name, APPLICATION_SCOPE); - } - - public JspWriter getOut() { - return out; - } - - public HttpSession getSession() { - return session; - } - - public Servlet getServlet() { - return servlet; - } - - public ServletConfig getServletConfig() { - return config; - } - - public ServletContext getServletContext() { - return config.getServletContext(); - } - - public ServletRequest getRequest() { - return request; - } - - public ServletResponse getResponse() { - return response; - } - - /** - * Returns the exception associated with this page context, if any.

- * Added wrapping for Throwables to avoid ClassCastException: see Bugzilla - * 31171 for details. - * - * @return The Exception associated with this page context, if any. - */ - public Exception getException() { - Throwable t = JspRuntimeLibrary.getThrowable(request); - - // Only wrap if needed - if ((t != null) && (!(t instanceof Exception))) { - t = new JspException(t); - } - - return (Exception) t; - } - - public Object getPage() { - return servlet; - } - - private final String getAbsolutePathRelativeToContext(String relativeUrlPath) { - String path = relativeUrlPath; - - if (!path.startsWith("/")) { - String uri = (String) request - .getAttribute("javax.servlet.include.servlet_path"); - if (uri == null) - uri = ((HttpServletRequest) request).getServletPath(); - String baseURI = uri.substring(0, uri.lastIndexOf('/')); - path = baseURI + '/' + path; - } - - return path; - } - - public void include(String relativeUrlPath) throws ServletException, - IOException { - JspRuntimeLibrary - .include(request, response, relativeUrlPath, out, true); - } - - public void include(final String relativeUrlPath, final boolean flush) - throws ServletException, IOException { - if (SecurityUtil.isPackageProtectionEnabled()) { - try { - AccessController.doPrivileged(new PrivilegedExceptionAction() { - public Object run() throws Exception { - doInclude(relativeUrlPath, flush); - return null; - } - }); - } catch (PrivilegedActionException e) { - Exception ex = e.getException(); - if (ex instanceof IOException) { - throw (IOException) ex; - } else { - throw (ServletException) ex; - } - } - } else { - doInclude(relativeUrlPath, flush); - } - } - - private void doInclude(String relativeUrlPath, boolean flush) - throws ServletException, IOException { - JspRuntimeLibrary.include(request, response, relativeUrlPath, out, - flush); - } - - public VariableResolver getVariableResolver() { - return new VariableResolverImpl(this.getELContext()); - } - - public void forward(final String relativeUrlPath) throws ServletException, - IOException { - if (SecurityUtil.isPackageProtectionEnabled()) { - try { - AccessController.doPrivileged(new PrivilegedExceptionAction() { - public Object run() throws Exception { - doForward(relativeUrlPath); - return null; - } - }); - } catch (PrivilegedActionException e) { - Exception ex = e.getException(); - if (ex instanceof IOException) { - throw (IOException) ex; - } else { - throw (ServletException) ex; - } - } - } else { - doForward(relativeUrlPath); - } - } - - private void doForward(String relativeUrlPath) throws ServletException, - IOException { - - // JSP.4.5 If the buffer was flushed, throw IllegalStateException - try { - out.clear(); - } catch (IOException ex) { - IllegalStateException ise = new IllegalStateException(Localizer - .getMessage("jsp.error.attempt_to_clear_flushed_buffer")); - ise.initCause(ex); - throw ise; - } - - // Make sure that the response object is not the wrapper for include - while (response instanceof ServletResponseWrapperInclude) { - response = ((ServletResponseWrapperInclude) response).getResponse(); - } - - final String path = getAbsolutePathRelativeToContext(relativeUrlPath); - String includeUri = (String) request - .getAttribute(Constants.INC_SERVLET_PATH); - - if (includeUri != null) - request.removeAttribute(Constants.INC_SERVLET_PATH); - try { - context.getRequestDispatcher(path).forward(request, response); - } finally { - if (includeUri != null) - request.setAttribute(Constants.INC_SERVLET_PATH, includeUri); - } - } - - public BodyContent pushBody() { - return (BodyContent) pushBody(null); - } - - public JspWriter pushBody(Writer writer) { - depth++; - if (depth >= outs.length) { - BodyContentImpl[] newOuts = new BodyContentImpl[depth + 1]; - for (int i = 0; i < outs.length; i++) { - newOuts[i] = outs[i]; - } - newOuts[depth] = new BodyContentImpl(out); - outs = newOuts; - } - - outs[depth].setWriter(writer); - out = outs[depth]; - - // Update the value of the "out" attribute in the page scope - // attribute namespace of this PageContext - setAttribute(OUT, out); - - return outs[depth]; - } - - public JspWriter popBody() { - depth--; - if (depth >= 0) { - out = outs[depth]; - } else { - out = baseOut; - } - - // Update the value of the "out" attribute in the page scope - // attribute namespace of this PageContext - setAttribute(OUT, out); - - return out; - } - - /** - * Provides programmatic access to the ExpressionEvaluator. The JSP - * Container must return a valid instance of an ExpressionEvaluator that can - * parse EL expressions. - */ - public ExpressionEvaluator getExpressionEvaluator() { - return new ExpressionEvaluatorImpl(this.applicationContext.getExpressionFactory()); - } - - public void handlePageException(Exception ex) throws IOException, - ServletException { - // Should never be called since handleException() called with a - // Throwable in the generated servlet. - handlePageException((Throwable) ex); - } - - public void handlePageException(final Throwable t) throws IOException, - ServletException { - if (t == null) - throw new NullPointerException("null Throwable"); - - if (SecurityUtil.isPackageProtectionEnabled()) { - try { - AccessController.doPrivileged(new PrivilegedExceptionAction() { - public Object run() throws Exception { - doHandlePageException(t); - return null; - } - }); - } catch (PrivilegedActionException e) { - Exception ex = e.getException(); - if (ex instanceof IOException) { - throw (IOException) ex; - } else { - throw (ServletException) ex; - } - } - } else { - doHandlePageException(t); - } - - } - - private void doHandlePageException(Throwable t) throws IOException, - ServletException { - - if (errorPageURL != null && !errorPageURL.equals("")) { - - /* - * Set request attributes. Do not set the - * javax.servlet.error.exception attribute here (instead, set in the - * generated servlet code for the error page) in order to prevent - * the ErrorReportValve, which is invoked as part of forwarding the - * request to the error page, from throwing it if the response has - * not been committed (the response will have been committed if the - * error page is a JSP page). - */ - request.setAttribute("javax.servlet.jsp.jspException", t); - request.setAttribute("javax.servlet.error.status_code", - new Integer(HttpServletResponse.SC_INTERNAL_SERVER_ERROR)); - request.setAttribute("javax.servlet.error.request_uri", - ((HttpServletRequest) request).getRequestURI()); - request.setAttribute("javax.servlet.error.servlet_name", config - .getServletName()); - try { - forward(errorPageURL); - } catch (IllegalStateException ise) { - include(errorPageURL); - } - - // The error page could be inside an include. - - Object newException = request - .getAttribute("javax.servlet.error.exception"); - - // t==null means the attribute was not set. - if ((newException != null) && (newException == t)) { - request.removeAttribute("javax.servlet.error.exception"); - } - - // now clear the error code - to prevent double handling. - request.removeAttribute("javax.servlet.error.status_code"); - request.removeAttribute("javax.servlet.error.request_uri"); - request.removeAttribute("javax.servlet.error.status_code"); - request.removeAttribute("javax.servlet.jsp.jspException"); - - } else { - // Otherwise throw the exception wrapped inside a ServletException. - // Set the exception as the root cause in the ServletException - // to get a stack trace for the real problem - if (t instanceof IOException) - throw (IOException) t; - if (t instanceof ServletException) - throw (ServletException) t; - if (t instanceof RuntimeException) - throw (RuntimeException) t; - - Throwable rootCause = null; - if (t instanceof JspException) { - rootCause = ((JspException) t).getRootCause(); - } else if (t instanceof ELException) { - rootCause = ((ELException) t).getRootCause(); - } - - if (rootCause != null) { - throw new ServletException(t.getClass().getName() + ": " - + t.getMessage(), rootCause); - } - - throw new ServletException(t); - } - } - - private static String XmlEscape(String s) { - if (s == null) - return null; - StringBuffer sb = new StringBuffer(); - for (int i = 0; i < s.length(); i++) { - char c = s.charAt(i); - if (c == '<') { - sb.append("<"); - } else if (c == '>') { - sb.append(">"); - } else if (c == '\'') { - sb.append("'"); // ' - } else if (c == '&') { - sb.append("&"); - } else if (c == '"') { - sb.append("""); // " - } else { - sb.append(c); - } - } - return sb.toString(); - } - - /** - * Proprietary method to evaluate EL expressions. XXX - This method should - * go away once the EL interpreter moves out of JSTL and into its own - * project. For now, this is necessary because the standard machinery is too - * slow. - * - * @param expression - * The expression to be evaluated - * @param expectedType - * The expected resulting type - * @param pageContext - * The page context - * @param functionMap - * Maps prefix and name to Method - * @return The result of the evaluation - */ - public static Object proprietaryEvaluate(final String expression, - final Class expectedType, final PageContext pageContext, - final ProtectedFunctionMapper functionMap, final boolean escape) - throws ELException { - Object retValue; - final ExpressionFactory exprFactory = jspf.getJspApplicationContext(pageContext.getServletContext()).getExpressionFactory(); - if (SecurityUtil.isPackageProtectionEnabled()) { - try { - retValue = AccessController - .doPrivileged(new PrivilegedExceptionAction() { - - public Object run() throws Exception { - ELContextImpl ctx = (ELContextImpl) pageContext.getELContext(); - ctx.setFunctionMapper(new FunctionMapperImpl(functionMap)); - ValueExpression ve = exprFactory.createValueExpression(ctx, expression, expectedType); - return ve.getValue(ctx); - } - }); - } catch (PrivilegedActionException ex) { - Exception realEx = ex.getException(); - if (realEx instanceof ELException) { - throw (ELException) realEx; - } else { - throw new ELException(realEx); - } - } - } else { - ELContextImpl ctx = (ELContextImpl) pageContext.getELContext(); - ctx.setFunctionMapper(new FunctionMapperImpl(functionMap)); - ValueExpression ve = exprFactory.createValueExpression(ctx, expression, expectedType); - retValue = ve.getValue(ctx); - } - if (escape && retValue != null) { - retValue = XmlEscape(retValue.toString()); - } - - return retValue; - } - - public ELContext getELContext() { - if (this.elContext == null) { - this.elContext = this.applicationContext.createELContext(this); - } - return this.elContext; - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/PerThreadTagHandlerPool.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/PerThreadTagHandlerPool.java deleted file mode 100644 index 58640efcf..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/PerThreadTagHandlerPool.java +++ /dev/null @@ -1,134 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.util.Enumeration; -import java.util.Vector; - -import javax.servlet.ServletConfig; -import javax.servlet.jsp.JspException; -import javax.servlet.jsp.tagext.Tag; - -import org.apache.jasper.Constants; - -/** - * Thread-local based pool of tag handlers that can be reused. - * - * @author Jan Luehe - * @author Costin Manolache - */ -public class PerThreadTagHandlerPool extends TagHandlerPool { - - private int maxSize; - - // For cleanup - private Vector perThreadDataVector; - - private ThreadLocal perThread; - - private static class PerThreadData { - Tag handlers[]; - int current; - } - - /** - * Constructs a tag handler pool with the default capacity. - */ - public PerThreadTagHandlerPool() { - super(); - perThreadDataVector = new Vector(); - } - - protected void init(ServletConfig config) { - maxSize = Constants.MAX_POOL_SIZE; - String maxSizeS = getOption(config, OPTION_MAXSIZE, null); - if (maxSizeS != null) { - maxSize = Integer.parseInt(maxSizeS); - if (maxSize < 0) { - maxSize = Constants.MAX_POOL_SIZE; - } - } - - perThread = new ThreadLocal() { - protected Object initialValue() { - PerThreadData ptd = new PerThreadData(); - ptd.handlers = new Tag[maxSize]; - ptd.current = -1; - perThreadDataVector.addElement(ptd); - return ptd; - } - }; - } - - /** - * Gets the next available tag handler from this tag handler pool, - * instantiating one if this tag handler pool is empty. - * - * @param handlerClass Tag handler class - * - * @return Reused or newly instantiated tag handler - * - * @throws JspException if a tag handler cannot be instantiated - */ - public Tag get(Class handlerClass) throws JspException { - PerThreadData ptd = (PerThreadData)perThread.get(); - if(ptd.current >=0 ) { - return ptd.handlers[ptd.current--]; - } else { - try { - return (Tag) handlerClass.newInstance(); - } catch (Exception e) { - throw new JspException(e.getMessage(), e); - } - } - } - - /** - * Adds the given tag handler to this tag handler pool, unless this tag - * handler pool has already reached its capacity, in which case the tag - * handler's release() method is called. - * - * @param handler Tag handler to add to this tag handler pool - */ - public void reuse(Tag handler) { - PerThreadData ptd=(PerThreadData)perThread.get(); - if (ptd.current < (ptd.handlers.length - 1)) { - ptd.handlers[++ptd.current] = handler; - } else { - handler.release(); - } - } - - /** - * Calls the release() method of all tag handlers in this tag handler pool. - */ - public void release() { - Enumeration enumeration = perThreadDataVector.elements(); - while (enumeration.hasMoreElements()) { - PerThreadData ptd = (PerThreadData)enumeration.nextElement(); - if (ptd.handlers != null) { - for (int i=ptd.current; i>=0; i--) { - if (ptd.handlers[i] != null) { - ptd.handlers[i].release(); - } - } - } - } - } -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/ProtectedFunctionMapper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/ProtectedFunctionMapper.java deleted file mode 100644 index 309e21135..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/ProtectedFunctionMapper.java +++ /dev/null @@ -1,196 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.util.HashMap; -import java.security.AccessController; -import java.security.PrivilegedAction; -import java.security.PrivilegedExceptionAction; -import java.security.PrivilegedActionException; -import java.lang.reflect.Method; -import javax.servlet.jsp.el.FunctionMapper; - -import org.apache.jasper.security.SecurityUtil; - -/** - * Maps EL functions to their Java method counterparts. Keeps the actual Method - * objects protected so that JSP pages can't indirectly do reflection. - * - * @author Mark Roth - * @author Kin-man Chung - */ -public final class ProtectedFunctionMapper extends javax.el.FunctionMapper - implements FunctionMapper { - - /** - * Maps "prefix:name" to java.lang.Method objects. - */ - private HashMap fnmap = null; - - /** - * If there is only one function in the map, this is the Method for it. - */ - private Method theMethod = null; - - /** - * Constructor has protected access. - */ - private ProtectedFunctionMapper() { - } - - /** - * Generated Servlet and Tag Handler implementations call this method to - * retrieve an instance of the ProtectedFunctionMapper. This is necessary - * since generated code does not have access to create instances of classes - * in this package. - * - * @return A new protected function mapper. - */ - public static ProtectedFunctionMapper getInstance() { - ProtectedFunctionMapper funcMapper; - if (SecurityUtil.isPackageProtectionEnabled()) { - funcMapper = (ProtectedFunctionMapper) AccessController - .doPrivileged(new PrivilegedAction() { - public Object run() { - return new ProtectedFunctionMapper(); - } - }); - } else { - funcMapper = new ProtectedFunctionMapper(); - } - funcMapper.fnmap = new java.util.HashMap(); - return funcMapper; - } - - /** - * Stores a mapping from the given EL function prefix and name to the given - * Java method. - * - * @param fnQName - * The EL function qualified name (including prefix) - * @param c - * The class containing the Java method - * @param methodName - * The name of the Java method - * @param args - * The arguments of the Java method - * @throws RuntimeException - * if no method with the given signature could be found. - */ - public void mapFunction(String fnQName, final Class c, - final String methodName, final Class[] args) { - java.lang.reflect.Method method; - if (SecurityUtil.isPackageProtectionEnabled()) { - try { - method = (java.lang.reflect.Method) AccessController - .doPrivileged(new PrivilegedExceptionAction() { - - public Object run() throws Exception { - return c.getDeclaredMethod(methodName, args); - } - }); - } catch (PrivilegedActionException ex) { - throw new RuntimeException( - "Invalid function mapping - no such method: " - + ex.getException().getMessage()); - } - } else { - try { - method = c.getDeclaredMethod(methodName, args); - } catch (NoSuchMethodException e) { - throw new RuntimeException( - "Invalid function mapping - no such method: " - + e.getMessage()); - } - } - - this.fnmap.put(fnQName, method); - } - - /** - * Creates an instance for this class, and stores the Method for the given - * EL function prefix and name. This method is used for the case when there - * is only one function in the EL expression. - * - * @param fnQName - * The EL function qualified name (including prefix) - * @param c - * The class containing the Java method - * @param methodName - * The name of the Java method - * @param args - * The arguments of the Java method - * @throws RuntimeException - * if no method with the given signature could be found. - */ - public static ProtectedFunctionMapper getMapForFunction(String fnQName, - final Class c, final String methodName, final Class[] args) { - java.lang.reflect.Method method; - ProtectedFunctionMapper funcMapper; - if (SecurityUtil.isPackageProtectionEnabled()) { - funcMapper = (ProtectedFunctionMapper) AccessController - .doPrivileged(new PrivilegedAction() { - public Object run() { - return new ProtectedFunctionMapper(); - } - }); - - try { - method = (java.lang.reflect.Method) AccessController - .doPrivileged(new PrivilegedExceptionAction() { - - public Object run() throws Exception { - return c.getDeclaredMethod(methodName, args); - } - }); - } catch (PrivilegedActionException ex) { - throw new RuntimeException( - "Invalid function mapping - no such method: " - + ex.getException().getMessage()); - } - } else { - funcMapper = new ProtectedFunctionMapper(); - try { - method = c.getDeclaredMethod(methodName, args); - } catch (NoSuchMethodException e) { - throw new RuntimeException( - "Invalid function mapping - no such method: " - + e.getMessage()); - } - } - funcMapper.theMethod = method; - return funcMapper; - } - - /** - * Resolves the specified local name and prefix into a Java.lang.Method. - * Returns null if the prefix and local name are not found. - * - * @param prefix - * the prefix of the function - * @param localName - * the short name of the function - * @return the result of the method mapping. Null means no entry found. - */ - public Method resolveFunction(String prefix, String localName) { - if (this.fnmap != null) { - return (Method) this.fnmap.get(prefix + ":" + localName); - } - return theMethod; - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/ServletResponseWrapperInclude.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/ServletResponseWrapperInclude.java deleted file mode 100644 index 098e7038d..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/ServletResponseWrapperInclude.java +++ /dev/null @@ -1,76 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import java.io.IOException; -import java.io.PrintWriter; - -import javax.servlet.ServletOutputStream; -import javax.servlet.ServletResponse; -import javax.servlet.http.HttpServletResponse; -import javax.servlet.http.HttpServletResponseWrapper; -import javax.servlet.jsp.JspWriter; - -/** - * ServletResponseWrapper used by the JSP 'include' action. - * - * This wrapper response object is passed to RequestDispatcher.include(), so - * that the output of the included resource is appended to that of the - * including page. - * - * @author Pierre Delisle - */ - -public class ServletResponseWrapperInclude extends HttpServletResponseWrapper { - - /** - * PrintWriter which appends to the JspWriter of the including page. - */ - private PrintWriter printWriter; - - private JspWriter jspWriter; - - public ServletResponseWrapperInclude(ServletResponse response, - JspWriter jspWriter) { - super((HttpServletResponse)response); - this.printWriter = new PrintWriter(jspWriter); - this.jspWriter = jspWriter; - } - - /** - * Returns a wrapper around the JspWriter of the including page. - */ - public PrintWriter getWriter() throws IOException { - return printWriter; - } - - public ServletOutputStream getOutputStream() throws IOException { - throw new IllegalStateException(); - } - - /** - * Clears the output buffer of the JspWriter associated with the including - * page. - */ - public void resetBuffer() { - try { - jspWriter.clearBuffer(); - } catch (IOException ioe) { - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/TagHandlerPool.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/TagHandlerPool.java deleted file mode 100644 index 74f2b64bc..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/runtime/TagHandlerPool.java +++ /dev/null @@ -1,191 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.runtime; - -import javax.servlet.ServletConfig; -import javax.servlet.jsp.JspException; -import javax.servlet.jsp.tagext.Tag; - -import org.apache.AnnotationProcessor; -import org.apache.jasper.Constants; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * Pool of tag handlers that can be reused. - * - * @author Jan Luehe - */ -public class TagHandlerPool { - - private Tag[] handlers; - - public static String OPTION_TAGPOOL="tagpoolClassName"; - public static String OPTION_MAXSIZE="tagpoolMaxSize"; - - private Log log = LogFactory.getLog(TagHandlerPool.class); - - // index of next available tag handler - private int current; - protected AnnotationProcessor annotationProcessor = null; - - public static TagHandlerPool getTagHandlerPool( ServletConfig config) { - TagHandlerPool result=null; - - String tpClassName=getOption( config, OPTION_TAGPOOL, null); - if( tpClassName != null ) { - try { - Class c=Class.forName( tpClassName ); - result=(TagHandlerPool)c.newInstance(); - } catch (Exception e) { - e.printStackTrace(); - result=null; - } - } - if( result==null ) result=new TagHandlerPool(); - result.init(config); - - return result; - } - - protected void init( ServletConfig config ) { - int maxSize=-1; - String maxSizeS=getOption(config, OPTION_MAXSIZE, null); - if( maxSizeS != null ) { - try { - maxSize=Integer.parseInt(maxSizeS); - } catch( Exception ex) { - maxSize=-1; - } - } - if( maxSize <0 ) { - maxSize=Constants.MAX_POOL_SIZE; - } - this.handlers = new Tag[maxSize]; - this.current = -1; - this.annotationProcessor = - (AnnotationProcessor) config.getServletContext().getAttribute(AnnotationProcessor.class.getName()); - } - - /** - * Constructs a tag handler pool with the default capacity. - */ - public TagHandlerPool() { - // Nothing - jasper generated servlets call the other constructor, - // this should be used in future + init . - } - - /** - * Constructs a tag handler pool with the given capacity. - * - * @param capacity Tag handler pool capacity - * @deprecated Use static getTagHandlerPool - */ - public TagHandlerPool(int capacity) { - this.handlers = new Tag[capacity]; - this.current = -1; - } - - /** - * Gets the next available tag handler from this tag handler pool, - * instantiating one if this tag handler pool is empty. - * - * @param handlerClass Tag handler class - * - * @return Reused or newly instantiated tag handler - * - * @throws JspException if a tag handler cannot be instantiated - */ - public Tag get(Class handlerClass) throws JspException { - Tag handler = null; - synchronized( this ) { - if (current >= 0) { - handler = handlers[current--]; - return handler; - } - } - - // Out of sync block - there is no need for other threads to - // wait for us to construct a tag for this thread. - try { - Tag instance = (Tag) handlerClass.newInstance(); - AnnotationHelper.postConstruct(annotationProcessor, instance); - return instance; - } catch (Exception e) { - throw new JspException(e.getMessage(), e); - } - } - - /** - * Adds the given tag handler to this tag handler pool, unless this tag - * handler pool has already reached its capacity, in which case the tag - * handler's release() method is called. - * - * @param handler Tag handler to add to this tag handler pool - */ - public void reuse(Tag handler) { - synchronized( this ) { - if (current < (handlers.length - 1)) { - handlers[++current] = handler; - return; - } - } - // There is no need for other threads to wait for us to release - handler.release(); - if (annotationProcessor != null) { - try { - AnnotationHelper.preDestroy(annotationProcessor, handler); - } catch (Exception e) { - log.warn("Error processing preDestroy on tag instance of " - + handler.getClass().getName(), e); - } - } - } - - /** - * Calls the release() method of all available tag handlers in this tag - * handler pool. - */ - public synchronized void release() { - for (int i = current; i >= 0; i--) { - handlers[i].release(); - if (annotationProcessor != null) { - try { - AnnotationHelper.preDestroy(annotationProcessor, handlers[i]); - } catch (Exception e) { - log.warn("Error processing preDestroy on tag instance of " - + handlers[i].getClass().getName(), e); - } - } - } - } - - protected static String getOption( ServletConfig config, String name, String defaultV) { - if( config == null ) return defaultV; - - String value=config.getInitParameter(name); - if( value != null ) return value; - if( config.getServletContext() ==null ) - return defaultV; - value=config.getServletContext().getInitParameter(name); - if( value!=null ) return value; - return defaultV; - } - -} - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/security/SecurityClassLoad.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/security/SecurityClassLoad.java deleted file mode 100644 index 6c7cfc347..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/security/SecurityClassLoad.java +++ /dev/null @@ -1,111 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.security; - -/** - * Static class used to preload java classes when using the - * Java SecurityManager so that the defineClassInPackage - * RuntimePermission does not trigger an AccessControlException. - * - * @author Jean-Francois Arcand - */ - -public final class SecurityClassLoad { - - private static org.apache.juli.logging.Log log= - org.apache.juli.logging.LogFactory.getLog( SecurityClassLoad.class ); - - public static void securityClassLoad(ClassLoader loader){ - - if( System.getSecurityManager() == null ){ - return; - } - - String basePackage = "org.apache.jasper."; - try { - loader.loadClass( basePackage + - "runtime.JspFactoryImpl$PrivilegedGetPageContext"); - loader.loadClass( basePackage + - "runtime.JspFactoryImpl$PrivilegedReleasePageContext"); - - loader.loadClass( basePackage + - "runtime.JspRuntimeLibrary"); - loader.loadClass( basePackage + - "runtime.JspRuntimeLibrary$PrivilegedIntrospectHelper"); - - loader.loadClass( basePackage + - "runtime.ServletResponseWrapperInclude"); - loader.loadClass( basePackage + - "runtime.TagHandlerPool"); - loader.loadClass( basePackage + - "runtime.JspFragmentHelper"); - - loader.loadClass( basePackage + - "runtime.ProtectedFunctionMapper"); - loader.loadClass( basePackage + - "runtime.ProtectedFunctionMapper$1"); - loader.loadClass( basePackage + - "runtime.ProtectedFunctionMapper$2"); - loader.loadClass( basePackage + - "runtime.ProtectedFunctionMapper$3"); - loader.loadClass( basePackage + - "runtime.ProtectedFunctionMapper$4"); - - loader.loadClass( basePackage + - "runtime.PageContextImpl"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$1"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$2"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$3"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$4"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$5"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$6"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$7"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$8"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$9"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$10"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$11"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$12"); - loader.loadClass( basePackage + - "runtime.PageContextImpl$13"); - - loader.loadClass( basePackage + - "runtime.JspContextWrapper"); - - loader.loadClass( basePackage + - "servlet.JspServletWrapper"); - - loader.loadClass( basePackage + - "runtime.JspWriterImpl$1"); - } catch (ClassNotFoundException ex) { - log.error("SecurityClassLoad", ex); - } - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/security/SecurityUtil.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/security/SecurityUtil.java deleted file mode 100644 index 22d0668e4..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/security/SecurityUtil.java +++ /dev/null @@ -1,81 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ -package org.apache.jasper.security; - -import org.apache.jasper.Constants; - -/** - * Util class for Security related operations. - * - * @author Jean-Francois Arcand - */ - -public final class SecurityUtil{ - - private static boolean packageDefinitionEnabled = - System.getProperty("package.definition") == null ? false : true; - - /** - * Return the SecurityManager only if Security is enabled AND - * package protection mechanism is enabled. - */ - public static boolean isPackageProtectionEnabled(){ - if (packageDefinitionEnabled && Constants.IS_SECURITY_ENABLED){ - return true; - } - return false; - } - - - /** - * Filter the specified message string for characters that are sensitive - * in HTML. This avoids potential attacks caused by including JavaScript - * codes in the request URL that is often reported in error messages. - * - * @param message The message string to be filtered - */ - public static String filter(String message) { - - if (message == null) - return (null); - - char content[] = new char[message.length()]; - message.getChars(0, message.length(), content, 0); - StringBuffer result = new StringBuffer(content.length + 50); - for (int i = 0; i < content.length; i++) { - switch (content[i]) { - case '<': - result.append("<"); - break; - case '>': - result.append(">"); - break; - case '&': - result.append("&"); - break; - case '"': - result.append("""); - break; - default: - result.append(content[i]); - } - } - return (result.toString()); - - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JasperLoader.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JasperLoader.java deleted file mode 100644 index 7a3b0f72b..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JasperLoader.java +++ /dev/null @@ -1,172 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.servlet; - -import java.io.IOException; -import java.io.InputStream; -import java.net.URL; -import java.net.URLClassLoader; -import java.security.CodeSource; -import java.security.PermissionCollection; - -import org.apache.jasper.Constants; - -/** - * Class loader for loading servlet class files (corresponding to JSP files) - * and tag handler class files (corresponding to tag files). - * - * @author Anil K. Vijendran - * @author Harish Prabandham - * @author Jean-Francois Arcand - */ -public class JasperLoader extends URLClassLoader { - - private PermissionCollection permissionCollection; - private CodeSource codeSource; - private String className; - private ClassLoader parent; - private SecurityManager securityManager; - - public JasperLoader(URL[] urls, ClassLoader parent, - PermissionCollection permissionCollection, - CodeSource codeSource) { - super(urls, parent); - this.permissionCollection = permissionCollection; - this.codeSource = codeSource; - this.parent = parent; - this.securityManager = System.getSecurityManager(); - } - - /** - * Load the class with the specified name. This method searches for - * classes in the same manner as loadClass(String, boolean) - * with false as the second argument. - * - * @param name Name of the class to be loaded - * - * @exception ClassNotFoundException if the class was not found - */ - public Class loadClass(String name) throws ClassNotFoundException { - - return (loadClass(name, false)); - } - - /** - * Load the class with the specified name, searching using the following - * algorithm until it finds and returns the class. If the class cannot - * be found, returns ClassNotFoundException. - *

    - *
  • Call findLoadedClass(String) to check if the - * class has already been loaded. If it has, the same - * Class object is returned.
    • - *
  • If the delegate property is set to true, - * call the loadClass() method of the parent class - * loader, if any.
    • - *
  • Call findClass() to find this class in our locally - * defined repositories.
    • - *
  • Call the loadClass() method of our parent - * class loader, if any.
    • - *
- * If the class was found using the above steps, and the - * resolve flag is true, this method will then - * call resolveClass(Class) on the resulting Class object. - * - * @param name Name of the class to be loaded - * @param resolve If true then resolve the class - * - * @exception ClassNotFoundException if the class was not found - */ - public Class loadClass(final String name, boolean resolve) - throws ClassNotFoundException { - - Class clazz = null; - - // (0) Check our previously loaded class cache - clazz = findLoadedClass(name); - if (clazz != null) { - if (resolve) - resolveClass(clazz); - return (clazz); - } - - // (.5) Permission to access this class when using a SecurityManager - if (securityManager != null) { - int dot = name.lastIndexOf('.'); - if (dot >= 0) { - try { - // Do not call the security manager since by default, we grant that package. - if (!"org.apache.jasper.runtime".equalsIgnoreCase(name.substring(0,dot))){ - securityManager.checkPackageAccess(name.substring(0,dot)); - } - } catch (SecurityException se) { - String error = "Security Violation, attempt to use " + - "Restricted Class: " + name; - se.printStackTrace(); - throw new ClassNotFoundException(error); - } - } - } - - if( !name.startsWith(Constants.JSP_PACKAGE_NAME + '.') ) { - // Class is not in org.apache.jsp, therefore, have our - // parent load it - clazz = parent.loadClass(name); - if( resolve ) - resolveClass(clazz); - return clazz; - } - - return findClass(name); - } - - - /** - * Delegate to parent - * - * @see java.lang.ClassLoader#getResourceAsStream(java.lang.String) - */ - public InputStream getResourceAsStream(String name) { - InputStream is = parent.getResourceAsStream(name); - if (is == null) { - URL url = findResource(name); - if (url != null) { - try { - is = url.openStream(); - } catch (IOException e) { - is = null; - } - } - } - return is; - } - - - /** - * Get the Permissions for a CodeSource. - * - * Since this ClassLoader is only used for a JSP page in - * a web application context, we just return our preset - * PermissionCollection for the web app context. - * - * @param codeSource Code source where the code was loaded from - * @return PermissionCollection for CodeSource - */ - public final PermissionCollection getPermissions(CodeSource codeSource) { - return permissionCollection; - } -} \ No newline at end of file diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspCServletContext.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspCServletContext.java deleted file mode 100644 index d0f324911..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspCServletContext.java +++ /dev/null @@ -1,441 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.servlet; - - -import java.io.File; -import java.io.InputStream; -import java.io.PrintWriter; -import java.net.MalformedURLException; -import java.net.URL; -import java.util.Enumeration; -import java.util.HashSet; -import java.util.Hashtable; -import java.util.Set; -import java.util.Vector; - -import javax.servlet.RequestDispatcher; -import javax.servlet.Servlet; -import javax.servlet.ServletContext; -import javax.servlet.ServletException; - - -/** - * Simple ServletContext implementation without - * HTTP-specific methods. - * - * @author Peter Rossbach (pr@webapp.de) - */ - -public class JspCServletContext implements ServletContext { - - - // ----------------------------------------------------- Instance Variables - - - /** - * Servlet context attributes. - */ - protected Hashtable myAttributes; - - - /** - * The log writer we will write log messages to. - */ - protected PrintWriter myLogWriter; - - - /** - * The base URL (document root) for this context. - */ - protected URL myResourceBaseURL; - - - // ----------------------------------------------------------- Constructors - - - /** - * Create a new instance of this ServletContext implementation. - * - * @param aLogWriter PrintWriter which is used for log() calls - * @param aResourceBaseURL Resource base URL - */ - public JspCServletContext(PrintWriter aLogWriter, URL aResourceBaseURL) { - - myAttributes = new Hashtable(); - myLogWriter = aLogWriter; - myResourceBaseURL = aResourceBaseURL; - - } - - - // --------------------------------------------------------- Public Methods - - - /** - * Return the specified context attribute, if any. - * - * @param name Name of the requested attribute - */ - public Object getAttribute(String name) { - - return (myAttributes.get(name)); - - } - - - /** - * Return an enumeration of context attribute names. - */ - public Enumeration getAttributeNames() { - - return (myAttributes.keys()); - - } - - - /** - * Return the servlet context for the specified path. - * - * @param uripath Server-relative path starting with '/' - */ - public ServletContext getContext(String uripath) { - - return (null); - - } - - - /** - * Return the context path. - */ - public String getContextPath() { - - return (null); - - } - - - /** - * Return the specified context initialization parameter. - * - * @param name Name of the requested parameter - */ - public String getInitParameter(String name) { - - return (null); - - } - - - /** - * Return an enumeration of the names of context initialization - * parameters. - */ - public Enumeration getInitParameterNames() { - - return (new Vector().elements()); - - } - - - /** - * Return the Servlet API major version number. - */ - public int getMajorVersion() { - - return (2); - - } - - - /** - * Return the MIME type for the specified filename. - * - * @param file Filename whose MIME type is requested - */ - public String getMimeType(String file) { - - return (null); - - } - - - /** - * Return the Servlet API minor version number. - */ - public int getMinorVersion() { - - return (3); - - } - - - /** - * Return a request dispatcher for the specified servlet name. - * - * @param name Name of the requested servlet - */ - public RequestDispatcher getNamedDispatcher(String name) { - - return (null); - - } - - - /** - * Return the real path for the specified context-relative - * virtual path. - * - * @param path The context-relative virtual path to resolve - */ - public String getRealPath(String path) { - - if (!myResourceBaseURL.getProtocol().equals("file")) - return (null); - if (!path.startsWith("/")) - return (null); - try { - return - (getResource(path).getFile().replace('/', File.separatorChar)); - } catch (Throwable t) { - return (null); - } - - } - - - /** - * Return a request dispatcher for the specified context-relative path. - * - * @param path Context-relative path for which to acquire a dispatcher - */ - public RequestDispatcher getRequestDispatcher(String path) { - - return (null); - - } - - - /** - * Return a URL object of a resource that is mapped to the - * specified context-relative path. - * - * @param path Context-relative path of the desired resource - * - * @exception MalformedURLException if the resource path is - * not properly formed - */ - public URL getResource(String path) throws MalformedURLException { - - if (!path.startsWith("/")) - throw new MalformedURLException("Path '" + path + - "' does not start with '/'"); - URL url = new URL(myResourceBaseURL, path.substring(1)); - InputStream is = null; - try { - is = url.openStream(); - } catch (Throwable t) { - url = null; - } finally { - if (is != null) { - try { - is.close(); - } catch (Throwable t2) { - // Ignore - } - } - } - return url; - - } - - - /** - * Return an InputStream allowing access to the resource at the - * specified context-relative path. - * - * @param path Context-relative path of the desired resource - */ - public InputStream getResourceAsStream(String path) { - - try { - return (getResource(path).openStream()); - } catch (Throwable t) { - return (null); - } - - } - - - /** - * Return the set of resource paths for the "directory" at the - * specified context path. - * - * @param path Context-relative base path - */ - public Set getResourcePaths(String path) { - - Set thePaths = new HashSet(); - if (!path.endsWith("/")) - path += "/"; - String basePath = getRealPath(path); - if (basePath == null) - return (thePaths); - File theBaseDir = new File(basePath); - if (!theBaseDir.exists() || !theBaseDir.isDirectory()) - return (thePaths); - String theFiles[] = theBaseDir.list(); - for (int i = 0; i < theFiles.length; i++) { - File testFile = new File(basePath + File.separator + theFiles[i]); - if (testFile.isFile()) - thePaths.add(path + theFiles[i]); - else if (testFile.isDirectory()) - thePaths.add(path + theFiles[i] + "/"); - } - return (thePaths); - - } - - - /** - * Return descriptive information about this server. - */ - public String getServerInfo() { - - return ("JspCServletContext/1.0"); - - } - - - /** - * Return a null reference for the specified servlet name. - * - * @param name Name of the requested servlet - * - * @deprecated This method has been deprecated with no replacement - */ - public Servlet getServlet(String name) throws ServletException { - - return (null); - - } - - - /** - * Return the name of this servlet context. - */ - public String getServletContextName() { - - return (getServerInfo()); - - } - - - /** - * Return an empty enumeration of servlet names. - * - * @deprecated This method has been deprecated with no replacement - */ - public Enumeration getServletNames() { - - return (new Vector().elements()); - - } - - - /** - * Return an empty enumeration of servlets. - * - * @deprecated This method has been deprecated with no replacement - */ - public Enumeration getServlets() { - - return (new Vector().elements()); - - } - - - /** - * Log the specified message. - * - * @param message The message to be logged - */ - public void log(String message) { - - myLogWriter.println(message); - - } - - - /** - * Log the specified message and exception. - * - * @param exception The exception to be logged - * @param message The message to be logged - * - * @deprecated Use log(String,Throwable) instead - */ - public void log(Exception exception, String message) { - - log(message, exception); - - } - - - /** - * Log the specified message and exception. - * - * @param message The message to be logged - * @param exception The exception to be logged - */ - public void log(String message, Throwable exception) { - - myLogWriter.println(message); - exception.printStackTrace(myLogWriter); - - } - - - /** - * Remove the specified context attribute. - * - * @param name Name of the attribute to remove - */ - public void removeAttribute(String name) { - - myAttributes.remove(name); - - } - - - /** - * Set or replace the specified context attribute. - * - * @param name Name of the context attribute to set - * @param value Corresponding attribute value - */ - public void setAttribute(String name, Object value) { - - myAttributes.put(name, value); - - } - - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspServlet.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspServlet.java deleted file mode 100644 index 1c1200358..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspServlet.java +++ /dev/null @@ -1,347 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.servlet; - -import java.io.IOException; -import java.lang.reflect.Constructor; -import java.util.Enumeration; - -import javax.servlet.ServletConfig; -import javax.servlet.ServletContext; -import javax.servlet.ServletException; -import javax.servlet.http.HttpServlet; -import javax.servlet.http.HttpServletRequest; -import javax.servlet.http.HttpServletResponse; - -import org.apache.PeriodicEventListener; - -import org.apache.jasper.Constants; -import org.apache.jasper.EmbeddedServletOptions; -import org.apache.jasper.Options; -import org.apache.jasper.compiler.JspRuntimeContext; -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.security.SecurityUtil; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * The JSP engine (a.k.a Jasper). - * - * The servlet container is responsible for providing a - * URLClassLoader for the web application context Jasper - * is being used in. Jasper will try get the Tomcat - * ServletContext attribute for its ServletContext class - * loader, if that fails, it uses the parent class loader. - * In either case, it must be a URLClassLoader. - * - * @author Anil K. Vijendran - * @author Harish Prabandham - * @author Remy Maucherat - * @author Kin-man Chung - * @author Glenn Nielsen - */ -public class JspServlet extends HttpServlet implements PeriodicEventListener { - - // Logger - private Log log = LogFactory.getLog(JspServlet.class); - - private ServletContext context; - private ServletConfig config; - private Options options; - private JspRuntimeContext rctxt; - - - /* - * Initializes this JspServlet. - */ - public void init(ServletConfig config) throws ServletException { - - super.init(config); - this.config = config; - this.context = config.getServletContext(); - - // Initialize the JSP Runtime Context - // Check for a custom Options implementation - String engineOptionsName = - config.getInitParameter("engineOptionsClass"); - if (engineOptionsName != null) { - // Instantiate the indicated Options implementation - try { - ClassLoader loader = Thread.currentThread() - .getContextClassLoader(); - Class engineOptionsClass = loader.loadClass(engineOptionsName); - Class[] ctorSig = { ServletConfig.class, ServletContext.class }; - Constructor ctor = engineOptionsClass.getConstructor(ctorSig); - Object[] args = { config, context }; - options = (Options) ctor.newInstance(args); - } catch (Throwable e) { - // Need to localize this. - log.warn("Failed to load engineOptionsClass", e); - // Use the default Options implementation - options = new EmbeddedServletOptions(config, context); - } - } else { - // Use the default Options implementation - options = new EmbeddedServletOptions(config, context); - } - rctxt = new JspRuntimeContext(context, options); - - if (log.isDebugEnabled()) { - log.debug(Localizer.getMessage("jsp.message.scratch.dir.is", - options.getScratchDir().toString())); - log.debug(Localizer.getMessage("jsp.message.dont.modify.servlets")); - } - } - - - /** - * Returns the number of JSPs for which JspServletWrappers exist, i.e., - * the number of JSPs that have been loaded into the webapp with which - * this JspServlet is associated. - * - *

This info may be used for monitoring purposes. - * - * @return The number of JSPs that have been loaded into the webapp with - * which this JspServlet is associated - */ - public int getJspCount() { - return this.rctxt.getJspCount(); - } - - - /** - * Resets the JSP reload counter. - * - * @param count Value to which to reset the JSP reload counter - */ - public void setJspReloadCount(int count) { - this.rctxt.setJspReloadCount(count); - } - - - /** - * Gets the number of JSPs that have been reloaded. - * - *

This info may be used for monitoring purposes. - * - * @return The number of JSPs (in the webapp with which this JspServlet is - * associated) that have been reloaded - */ - public int getJspReloadCount() { - return this.rctxt.getJspReloadCount(); - } - - - /** - *

Look for a precompilation request as described in - * Section 8.4.2 of the JSP 1.2 Specification. WARNING - - * we cannot use request.getParameter() for this, because - * that will trigger parsing all of the request parameters, and not give - * a servlet the opportunity to call - * request.setCharacterEncoding() first.

- * - * @param request The servlet requset we are processing - * - * @exception ServletException if an invalid parameter value for the - * jsp_precompile parameter name is specified - */ - boolean preCompile(HttpServletRequest request) throws ServletException { - - String queryString = request.getQueryString(); - if (queryString == null) { - return (false); - } - int start = queryString.indexOf(Constants.PRECOMPILE); - if (start < 0) { - return (false); - } - queryString = - queryString.substring(start + Constants.PRECOMPILE.length()); - if (queryString.length() == 0) { - return (true); // ?jsp_precompile - } - if (queryString.startsWith("&")) { - return (true); // ?jsp_precompile&foo=bar... - } - if (!queryString.startsWith("=")) { - return (false); // part of some other name or value - } - int limit = queryString.length(); - int ampersand = queryString.indexOf("&"); - if (ampersand > 0) { - limit = ampersand; - } - String value = queryString.substring(1, limit); - if (value.equals("true")) { - return (true); // ?jsp_precompile=true - } else if (value.equals("false")) { - // Spec says if jsp_precompile=false, the request should not - // be delivered to the JSP page; the easiest way to implement - // this is to set the flag to true, and precompile the page anyway. - // This still conforms to the spec, since it says the - // precompilation request can be ignored. - return (true); // ?jsp_precompile=false - } else { - throw new ServletException("Cannot have request parameter " + - Constants.PRECOMPILE + " set to " + - value); - } - - } - - - public void service (HttpServletRequest request, - HttpServletResponse response) - throws ServletException, IOException { - - String jspUri = null; - - String jspFile = (String) request.getAttribute(Constants.JSP_FILE); - if (jspFile != null) { - // JSP is specified via in declaration - jspUri = jspFile; - } else { - /* - * Check to see if the requested JSP has been the target of a - * RequestDispatcher.include() - */ - jspUri = (String) request.getAttribute(Constants.INC_SERVLET_PATH); - if (jspUri != null) { - /* - * Requested JSP has been target of - * RequestDispatcher.include(). Its path is assembled from the - * relevant javax.servlet.include.* request attributes - */ - String pathInfo = (String) request.getAttribute( - "javax.servlet.include.path_info"); - if (pathInfo != null) { - jspUri += pathInfo; - } - } else { - /* - * Requested JSP has not been the target of a - * RequestDispatcher.include(). Reconstruct its path from the - * request's getServletPath() and getPathInfo() - */ - jspUri = request.getServletPath(); - String pathInfo = request.getPathInfo(); - if (pathInfo != null) { - jspUri += pathInfo; - } - } - } - - if (log.isDebugEnabled()) { - log.debug("JspEngine --> " + jspUri); - log.debug("\t ServletPath: " + request.getServletPath()); - log.debug("\t PathInfo: " + request.getPathInfo()); - log.debug("\t RealPath: " + context.getRealPath(jspUri)); - log.debug("\t RequestURI: " + request.getRequestURI()); - log.debug("\t QueryString: " + request.getQueryString()); - log.debug("\t Request Params: "); - Enumeration e = request.getParameterNames(); - while (e.hasMoreElements()) { - String name = (String) e.nextElement(); - log.debug("\t\t " + name + " = " - + request.getParameter(name)); - } - } - - try { - boolean precompile = preCompile(request); - serviceJspFile(request, response, jspUri, null, precompile); - } catch (RuntimeException e) { - throw e; - } catch (ServletException e) { - throw e; - } catch (IOException e) { - throw e; - } catch (Throwable e) { - throw new ServletException(e); - } - - } - - public void destroy() { - if (log.isDebugEnabled()) { - log.debug("JspServlet.destroy()"); - } - - rctxt.destroy(); - } - - - public void periodicEvent() { - rctxt.checkCompile(); - } - - // -------------------------------------------------------- Private Methods - - private void serviceJspFile(HttpServletRequest request, - HttpServletResponse response, String jspUri, - Throwable exception, boolean precompile) - throws ServletException, IOException { - - JspServletWrapper wrapper = - (JspServletWrapper) rctxt.getWrapper(jspUri); - if (wrapper == null) { - synchronized(this) { - wrapper = (JspServletWrapper) rctxt.getWrapper(jspUri); - if (wrapper == null) { - // Check if the requested JSP page exists, to avoid - // creating unnecessary directories and files. - if (null == context.getResource(jspUri)) { - String includeRequestUri = (String) - request.getAttribute( - "javax.servlet.include.request_uri"); - if (includeRequestUri != null) { - // This file was included. Throw an exception as - // a response.sendError() will be ignored - String msg = Localizer.getMessage( - "jsp.error.file.not.found",jspUri); - // Strictly, filtering this is an application - // responsibility but just in case... - throw new ServletException( - SecurityUtil.filter(msg)); - } else { - try { - response.sendError( - HttpServletResponse.SC_NOT_FOUND, - request.getRequestURI()); - } catch (IllegalStateException ise) { - log.error(Localizer.getMessage( - "jsp.error.file.not.found", - jspUri)); - } - } - return; - } - boolean isErrorPage = exception != null; - wrapper = new JspServletWrapper(config, options, jspUri, - isErrorPage, rctxt); - rctxt.addWrapper(jspUri,wrapper); - } - } - } - - wrapper.service(request, response, precompile); - - } - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspServletWrapper.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspServletWrapper.java deleted file mode 100644 index 48db4230e..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/servlet/JspServletWrapper.java +++ /dev/null @@ -1,527 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.servlet; - -import java.io.FileNotFoundException; -import java.io.IOException; -import java.net.URL; - -import javax.servlet.Servlet; -import javax.servlet.ServletConfig; -import javax.servlet.ServletContext; -import javax.servlet.ServletException; -import javax.servlet.SingleThreadModel; -import javax.servlet.UnavailableException; -import javax.servlet.http.HttpServletRequest; -import javax.servlet.http.HttpServletResponse; -import javax.servlet.jsp.tagext.TagInfo; - -import org.apache.AnnotationProcessor; -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.Options; -import org.apache.jasper.compiler.ErrorDispatcher; -import org.apache.jasper.compiler.JavacErrorDetail; -import org.apache.jasper.compiler.JspRuntimeContext; -import org.apache.jasper.compiler.Localizer; -import org.apache.jasper.runtime.JspSourceDependent; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; - -/** - * The JSP engine (a.k.a Jasper). - * - * The servlet container is responsible for providing a - * URLClassLoader for the web application context Jasper - * is being used in. Jasper will try get the Tomcat - * ServletContext attribute for its ServletContext class - * loader, if that fails, it uses the parent class loader. - * In either case, it must be a URLClassLoader. - * - * @author Anil K. Vijendran - * @author Harish Prabandham - * @author Remy Maucherat - * @author Kin-man Chung - * @author Glenn Nielsen - * @author Tim Fennell - */ - -public class JspServletWrapper { - - // Logger - private Log log = LogFactory.getLog(JspServletWrapper.class); - - private Servlet theServlet; - private String jspUri; - private Class servletClass; - private Class tagHandlerClass; - private JspCompilationContext ctxt; - private long available = 0L; - private ServletConfig config; - private Options options; - private boolean firstTime = true; - private boolean reload = true; - private boolean isTagFile; - private int tripCount; - private JasperException compileException; - private long servletClassLastModifiedTime; - private long lastModificationTest = 0L; - - /* - * JspServletWrapper for JSP pages. - */ - public JspServletWrapper(ServletConfig config, Options options, String jspUri, - boolean isErrorPage, JspRuntimeContext rctxt) - throws JasperException { - - this.isTagFile = false; - this.config = config; - this.options = options; - this.jspUri = jspUri; - ctxt = new JspCompilationContext(jspUri, isErrorPage, options, - config.getServletContext(), - this, rctxt); - } - - /* - * JspServletWrapper for tag files. - */ - public JspServletWrapper(ServletContext servletContext, - Options options, - String tagFilePath, - TagInfo tagInfo, - JspRuntimeContext rctxt, - URL tagFileJarUrl) - throws JasperException { - - this.isTagFile = true; - this.config = null; // not used - this.options = options; - this.jspUri = tagFilePath; - this.tripCount = 0; - ctxt = new JspCompilationContext(jspUri, tagInfo, options, - servletContext, this, rctxt, - tagFileJarUrl); - } - - public JspCompilationContext getJspEngineContext() { - return ctxt; - } - - public void setReload(boolean reload) { - this.reload = reload; - } - - public Servlet getServlet() - throws ServletException, IOException, FileNotFoundException - { - if (reload) { - synchronized (this) { - // Synchronizing on jsw enables simultaneous loading - // of different pages, but not the same page. - if (reload) { - // This is to maintain the original protocol. - destroy(); - - Servlet servlet = null; - - try { - servletClass = ctxt.load(); - servlet = (Servlet) servletClass.newInstance(); - AnnotationProcessor annotationProcessor = (AnnotationProcessor) config.getServletContext().getAttribute(AnnotationProcessor.class.getName()); - if (annotationProcessor != null) { - annotationProcessor.processAnnotations(servlet); - annotationProcessor.postConstruct(servlet); - } - } catch (IllegalAccessException e) { - throw new JasperException(e); - } catch (InstantiationException e) { - throw new JasperException(e); - } catch (Exception e) { - throw new JasperException(e); - } - - servlet.init(config); - - if (!firstTime) { - ctxt.getRuntimeContext().incrementJspReloadCount(); - } - - theServlet = servlet; - reload = false; - } - } - } - return theServlet; - } - - public ServletContext getServletContext() { - return config.getServletContext(); - } - - /** - * Sets the compilation exception for this JspServletWrapper. - * - * @param je The compilation exception - */ - public void setCompilationException(JasperException je) { - this.compileException = je; - } - - /** - * Sets the last-modified time of the servlet class file associated with - * this JspServletWrapper. - * - * @param lastModified Last-modified time of servlet class - */ - public void setServletClassLastModifiedTime(long lastModified) { - if (this.servletClassLastModifiedTime < lastModified) { - synchronized (this) { - if (this.servletClassLastModifiedTime < lastModified) { - this.servletClassLastModifiedTime = lastModified; - reload = true; - } - } - } - } - - /** - * Compile (if needed) and load a tag file - */ - public Class loadTagFile() throws JasperException { - - try { - if (ctxt.isRemoved()) { - throw new FileNotFoundException(jspUri); - } - if (options.getDevelopment() || firstTime ) { - synchronized (this) { - firstTime = false; - ctxt.compile(); - } - } else { - if (compileException != null) { - throw compileException; - } - } - - if (reload) { - tagHandlerClass = ctxt.load(); - reload = false; - } - } catch (FileNotFoundException ex) { - throw new JasperException(ex); - } - - return tagHandlerClass; - } - - /** - * Compile and load a prototype for the Tag file. This is needed - * when compiling tag files with circular dependencies. A prototpe - * (skeleton) with no dependencies on other other tag files is - * generated and compiled. - */ - public Class loadTagFilePrototype() throws JasperException { - - ctxt.setPrototypeMode(true); - try { - return loadTagFile(); - } finally { - ctxt.setPrototypeMode(false); - } - } - - /** - * Get a list of files that the current page has source dependency on. - */ - public java.util.List getDependants() { - try { - Object target; - if (isTagFile) { - if (reload) { - tagHandlerClass = ctxt.load(); - reload = false; - } - target = tagHandlerClass.newInstance(); - } else { - target = getServlet(); - } - if (target != null && target instanceof JspSourceDependent) { - return ((java.util.List) ((JspSourceDependent) target).getDependants()); - } - } catch (Throwable ex) { - } - return null; - } - - public boolean isTagFile() { - return this.isTagFile; - } - - public int incTripCount() { - return tripCount++; - } - - public int decTripCount() { - return tripCount--; - } - - public void service(HttpServletRequest request, - HttpServletResponse response, - boolean precompile) - throws ServletException, IOException, FileNotFoundException { - - try { - - if (ctxt.isRemoved()) { - throw new FileNotFoundException(jspUri); - } - - if ((available > 0L) && (available < Long.MAX_VALUE)) { - if (available > System.currentTimeMillis()) { - response.setDateHeader("Retry-After", available); - response.sendError - (HttpServletResponse.SC_SERVICE_UNAVAILABLE, - Localizer.getMessage("jsp.error.unavailable")); - return; - } else { - // Wait period has expired. Reset. - available = 0; - } - } - - /* - * (1) Compile - */ - if (options.getDevelopment() || firstTime ) { - synchronized (this) { - firstTime = false; - - // The following sets reload to true, if necessary - ctxt.compile(); - } - } else { - if (compileException != null) { - // Throw cached compilation exception - throw compileException; - } - } - - /* - * (2) (Re)load servlet class file - */ - getServlet(); - - // If a page is to be precompiled only, return. - if (precompile) { - return; - } - - } catch (ServletException ex) { - if (options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw ex; - } - } catch (IOException ex) { - if (options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw ex; - } - } catch (IllegalStateException ex) { - if (options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw ex; - } - } catch (Exception ex) { - if (options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw new JasperException(ex); - } - } - - try { - - /* - * (3) Service request - */ - if (theServlet instanceof SingleThreadModel) { - // sync on the wrapper so that the freshness - // of the page is determined right before servicing - synchronized (this) { - theServlet.service(request, response); - } - } else { - theServlet.service(request, response); - } - - } catch (UnavailableException ex) { - String includeRequestUri = (String) - request.getAttribute("javax.servlet.include.request_uri"); - if (includeRequestUri != null) { - // This file was included. Throw an exception as - // a response.sendError() will be ignored by the - // servlet engine. - throw ex; - } else { - int unavailableSeconds = ex.getUnavailableSeconds(); - if (unavailableSeconds <= 0) { - unavailableSeconds = 60; // Arbitrary default - } - available = System.currentTimeMillis() + - (unavailableSeconds * 1000L); - response.sendError - (HttpServletResponse.SC_SERVICE_UNAVAILABLE, - ex.getMessage()); - } - } catch (ServletException ex) { - if(options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw ex; - } - } catch (IOException ex) { - if(options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw ex; - } - } catch (IllegalStateException ex) { - if(options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw ex; - } - } catch (Exception ex) { - if(options.getDevelopment()) { - throw handleJspException(ex); - } else { - throw new JasperException(ex); - } - } - } - - public void destroy() { - if (theServlet != null) { - theServlet.destroy(); - AnnotationProcessor annotationProcessor = (AnnotationProcessor) config.getServletContext().getAttribute(AnnotationProcessor.class.getName()); - if (annotationProcessor != null) { - try { - annotationProcessor.preDestroy(theServlet); - } catch (Exception e) { - // Log any exception, since it can't be passed along - log.error(Localizer.getMessage("jsp.error.file.not.found", - e.getMessage()), e); - } - } - } - } - - /** - * @return Returns the lastModificationTest. - */ - public long getLastModificationTest() { - return lastModificationTest; - } - /** - * @param lastModificationTest The lastModificationTest to set. - */ - public void setLastModificationTest(long lastModificationTest) { - this.lastModificationTest = lastModificationTest; - } - - /** - *

Attempts to construct a JasperException that contains helpful information - * about what went wrong. Uses the JSP compiler system to translate the line - * number in the generated servlet that originated the exception to a line - * number in the JSP. Then constructs an exception containing that - * information, and a snippet of the JSP to help debugging. - * Please see http://issues.apache.org/bugzilla/show_bug.cgi?id=37062 and - * http://www.tfenne.com/jasper/ for more details. - *

- * - * @param ex the exception that was the cause of the problem. - * @return a JasperException with more detailed information - */ - protected JasperException handleJspException(Exception ex) { - try { - Throwable realException = ex; - if (ex instanceof ServletException) { - realException = ((ServletException) ex).getRootCause(); - } - - // First identify the stack frame in the trace that represents the JSP - StackTraceElement[] frames = realException.getStackTrace(); - StackTraceElement jspFrame = null; - - for (int i=0; i - - - - - - - - - - - - \ No newline at end of file diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/Util.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/Util.java deleted file mode 100644 index dfe0f2f5a..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/Util.java +++ /dev/null @@ -1,328 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl; - -import org.apache.jasper.Constants; - -import java.io.ByteArrayOutputStream; -import java.io.IOException; -import java.io.PrintWriter; -import java.io.StringWriter; -import java.io.UnsupportedEncodingException; -import java.util.Locale; - -import javax.servlet.ServletOutputStream; -import javax.servlet.http.HttpServletRequest; -import javax.servlet.http.HttpServletResponse; -import javax.servlet.http.HttpServletResponseWrapper; -import javax.servlet.jsp.JspException; -import javax.servlet.jsp.JspTagException; -import javax.servlet.jsp.PageContext; - -/** - * Util contains some often used consts, static methods and embedded class - * to support the JSTL tag plugin. - */ - -public class Util { - - public static final String VALID_SCHEME_CHAR = - "abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789+.-"; - - public static final String DEFAULT_ENCODING = - "ISO-8859-1"; - - public static final int HIGHEST_SPECIAL = '>'; - - public static char[][] specialCharactersRepresentation = new char[HIGHEST_SPECIAL + 1][]; - - static { - specialCharactersRepresentation['&'] = "&".toCharArray(); - specialCharactersRepresentation['<'] = "<".toCharArray(); - specialCharactersRepresentation['>'] = ">".toCharArray(); - specialCharactersRepresentation['"'] = """.toCharArray(); - specialCharactersRepresentation['\''] = "'".toCharArray(); - } - - /** - * Converts the given string description of a scope to the corresponding - * PageContext constant. - * - * The validity of the given scope has already been checked by the - * appropriate TLV. - * - * @param scope String description of scope - * - * @return PageContext constant corresponding to given scope description - * - * taken from org.apache.taglibs.standard.tag.common.core.Util - */ - public static int getScope(String scope){ - int ret = PageContext.PAGE_SCOPE; - - if("request".equalsIgnoreCase(scope)){ - ret = PageContext.REQUEST_SCOPE; - }else if("session".equalsIgnoreCase(scope)){ - ret = PageContext.SESSION_SCOPE; - }else if("application".equalsIgnoreCase(scope)){ - ret = PageContext.APPLICATION_SCOPE; - } - - return ret; - } - - /** - * Returns true if our current URL is absolute, - * false otherwise. - * taken from org.apache.taglibs.standard.tag.common.core.ImportSupport - */ - public static boolean isAbsoluteUrl(String url){ - if(url == null){ - return false; - } - - int colonPos = url.indexOf(":"); - if(colonPos == -1){ - return false; - } - - for(int i=0;iurl. The session ID - * is encoded as a URL "path parameter" beginning with "jsessionid=". - * We thus remove anything we find between ";jsessionid=" (inclusive) - * and either EOS or a subsequent ';' (exclusive). - * - * taken from org.apache.taglibs.standard.tag.common.core.ImportSupport - */ - public static String stripSession(String url) { - StringBuffer u = new StringBuffer(url); - int sessionStart; - while ((sessionStart = u.toString().indexOf(";" + Constants.SESSION_PARAMETER_NAME + "=")) != -1) { - int sessionEnd = u.toString().indexOf(";", sessionStart + 1); - if (sessionEnd == -1) - sessionEnd = u.toString().indexOf("?", sessionStart + 1); - if (sessionEnd == -1) // still - sessionEnd = u.length(); - u.delete(sessionStart, sessionEnd); - } - return u.toString(); - } - - - /** - * Performs the following substring replacements - * (to facilitate output to XML/HTML pages): - * - * & -> & - * < -> < - * > -> > - * " -> " - * ' -> ' - * - * See also OutSupport.writeEscapedXml(). - * - * taken from org.apache.taglibs.standard.tag.common.core.Util - */ - public static String escapeXml(String buffer) { - int start = 0; - int length = buffer.length(); - char[] arrayBuffer = buffer.toCharArray(); - StringBuffer escapedBuffer = null; - - for (int i = 0; i < length; i++) { - char c = arrayBuffer[i]; - if (c <= HIGHEST_SPECIAL) { - char[] escaped = specialCharactersRepresentation[c]; - if (escaped != null) { - // create StringBuffer to hold escaped xml string - if (start == 0) { - escapedBuffer = new StringBuffer(length + 5); - } - // add unescaped portion - if (start < i) { - escapedBuffer.append(arrayBuffer,start,i-start); - } - start = i + 1; - // add escaped xml - escapedBuffer.append(escaped); - } - } - } - // no xml escaping was necessary - if (start == 0) { - return buffer; - } - // add rest of unescaped portion - if (start < length) { - escapedBuffer.append(arrayBuffer,start,length-start); - } - return escapedBuffer.toString(); - } - - /** Utility methods - * taken from org.apache.taglibs.standard.tag.common.core.UrlSupport - */ - public static String resolveUrl( - String url, String context, PageContext pageContext) - throws JspException { - // don't touch absolute URLs - if (isAbsoluteUrl(url)) - return url; - - // normalize relative URLs against a context root - HttpServletRequest request = - (HttpServletRequest) pageContext.getRequest(); - if (context == null) { - if (url.startsWith("/")) - return (request.getContextPath() + url); - else - return url; - } else { - if (!context.startsWith("/") || !url.startsWith("/")) { - throw new JspTagException( - "In URL tags, when the \"context\" attribute is specified, values of both \"context\" and \"url\" must start with \"/\"."); - } - if (context.equals("/")) { - // Don't produce string starting with '//', many - // browsers interpret this as host name, not as - // path on same host. - return url; - } else { - return (context + url); - } - } - } - - /** Wraps responses to allow us to retrieve results as Strings. - * mainly taken from org.apache.taglibs.standard.tag.common.core.importSupport - */ - public static class ImportResponseWrapper extends HttpServletResponseWrapper{ - - private StringWriter sw = new StringWriter(); - private ByteArrayOutputStream bos = new ByteArrayOutputStream(); - private ServletOutputStream sos = new ServletOutputStream() { - public void write(int b) throws IOException { - bos.write(b); - } - }; - private boolean isWriterUsed; - private boolean isStreamUsed; - private int status = 200; - private String charEncoding; - - public ImportResponseWrapper(HttpServletResponse arg0) { - super(arg0); - // TODO Auto-generated constructor stub - } - - public PrintWriter getWriter() { - if (isStreamUsed) - throw new IllegalStateException("Unexpected internal error during <import>: " + - "Target servlet called getWriter(), then getOutputStream()"); - isWriterUsed = true; - return new PrintWriter(sw); - } - - public ServletOutputStream getOutputStream() { - if (isWriterUsed) - throw new IllegalStateException("Unexpected internal error during <import>: " + - "Target servlet called getOutputStream(), then getWriter()"); - isStreamUsed = true; - return sos; - } - - /** Has no effect. */ - public void setContentType(String x) { - // ignore - } - - /** Has no effect. */ - public void setLocale(Locale x) { - // ignore - } - - public void setStatus(int status) { - this.status = status; - } - - public int getStatus() { - return status; - } - - public String getCharEncoding(){ - return this.charEncoding; - } - - public void setCharEncoding(String ce){ - this.charEncoding = ce; - } - - public String getString() throws UnsupportedEncodingException { - if (isWriterUsed) - return sw.toString(); - else if (isStreamUsed) { - if (this.charEncoding != null && !this.charEncoding.equals("")) - return bos.toString(charEncoding); - else - return bos.toString("ISO-8859-1"); - } else - return ""; // target didn't write anything - } - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Catch.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Catch.java deleted file mode 100644 index c7d154aa4..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Catch.java +++ /dev/null @@ -1,72 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; - -public class Catch implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - //flag for the existence of the var attribute - boolean hasVar = ctxt.isAttributeSpecified("var"); - - //temp name for exception and caught - String exceptionName = ctxt.getTemporaryVariableName(); - String caughtName = ctxt.getTemporaryVariableName(); - - //main part to generate code - ctxt.generateJavaSource("boolean " + caughtName + " = false;"); - ctxt.generateJavaSource("try{"); - ctxt.generateBody(); - ctxt.generateJavaSource("}"); - - //do catch - ctxt.generateJavaSource("catch(Throwable " + exceptionName + "){"); - - //if the var specified, the exception object should - //be set to the attribute "var" defines in page scope - if(hasVar){ - String strVar = ctxt.getConstantAttribute("var"); - ctxt.generateJavaSource(" pageContext.setAttribute(\"" + strVar + "\", " - + exceptionName + ", PageContext.PAGE_SCOPE);"); - } - - //whenever there's exception caught, - //the flag caught should be set true; - ctxt.generateJavaSource(" " + caughtName + " = true;"); - ctxt.generateJavaSource("}"); - - //do finally - ctxt.generateJavaSource("finally{"); - - //if var specified, the attribute it defines - //in page scope should be removed - if(hasVar){ - String strVar = ctxt.getConstantAttribute("var"); - ctxt.generateJavaSource(" if(!" + caughtName + "){"); - ctxt.generateJavaSource(" pageContext.removeAttribute(\"" + strVar + "\", PageContext.PAGE_SCOPE);"); - ctxt.generateJavaSource(" }"); - } - - ctxt.generateJavaSource("}"); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Choose.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Choose.java deleted file mode 100644 index 7622ceea2..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Choose.java +++ /dev/null @@ -1,34 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.*; - -public final class Choose implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - // Not much to do here, much of the work will be done in the - // containing tags, and . - - ctxt.generateBody(); - // See comments in When.java for the reason "}" is generated here. - ctxt.generateJavaSource("}"); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/ForEach.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/ForEach.java deleted file mode 100644 index 49c9a3fcd..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/ForEach.java +++ /dev/null @@ -1,344 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.*; - -public final class ForEach implements TagPlugin { - - private boolean hasVar, hasBegin, hasEnd, hasStep; - - public void doTag(TagPluginContext ctxt) { - - String index = null; - - boolean hasVarStatus = ctxt.isAttributeSpecified("varStatus"); - if (hasVarStatus) { - ctxt.dontUseTagPlugin(); - return; - } - - hasVar = ctxt.isAttributeSpecified("var"); - hasBegin = ctxt.isAttributeSpecified("begin"); - hasEnd = ctxt.isAttributeSpecified("end"); - hasStep = ctxt.isAttributeSpecified("step"); - - boolean hasItems = ctxt.isAttributeSpecified("items"); - if (hasItems) { - doCollection(ctxt); - return; - } - - // We must have a begin and end attributes - index = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("for (int " + index + " = "); - ctxt.generateAttribute("begin"); - ctxt.generateJavaSource("; " + index + " <= "); - ctxt.generateAttribute("end"); - if (hasStep) { - ctxt.generateJavaSource("; " + index + "+="); - ctxt.generateAttribute("step"); - ctxt.generateJavaSource(") {"); - } - else { - ctxt.generateJavaSource("; " + index + "++) {"); - } - - // If var is specified and the body contains an EL, then sycn - // the var attribute - if (hasVar /* && ctxt.hasEL() */) { - ctxt.generateJavaSource("_jspx_page_context.setAttribute("); - ctxt.generateAttribute("var"); - ctxt.generateJavaSource(", String.valueOf(" + index + "));"); - } - ctxt.generateBody(); - ctxt.generateJavaSource("}"); - } - - /** - * Generate codes for Collections - * The pseudo code is: - */ - private void doCollection(TagPluginContext ctxt) { - - ctxt.generateImport("java.util.*"); - generateIterators(ctxt); - - String itemsV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("Object " + itemsV + "= "); - ctxt.generateAttribute("items"); - ctxt.generateJavaSource(";"); - - String indexV=null, beginV=null, endV=null, stepV=null; - if (hasBegin) { - beginV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("int " + beginV + " = "); - ctxt.generateAttribute("begin"); - ctxt.generateJavaSource(";"); - } - if (hasEnd) { - indexV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("int " + indexV + " = 0;"); - endV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("int " + endV + " = "); - ctxt.generateAttribute("end"); - ctxt.generateJavaSource(";"); - } - if (hasStep) { - stepV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("int " + stepV + " = "); - ctxt.generateAttribute("step"); - ctxt.generateJavaSource(";"); - } - - String iterV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("Iterator " + iterV + " = null;"); - // Object[] - ctxt.generateJavaSource("if (" + itemsV + " instanceof Object[])"); - ctxt.generateJavaSource(iterV + "=toIterator((Object[])" + itemsV + ");"); - // boolean[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof boolean[])"); - ctxt.generateJavaSource(iterV + "=toIterator((boolean[])" + itemsV + ");"); - // byte[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof byte[])"); - ctxt.generateJavaSource(iterV + "=toIterator((byte[])" + itemsV + ");"); - // char[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof char[])"); - ctxt.generateJavaSource(iterV + "=toIterator((char[])" + itemsV + ");"); - // short[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof short[])"); - ctxt.generateJavaSource(iterV + "=toIterator((short[])" + itemsV + ");"); - // int[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof int[])"); - ctxt.generateJavaSource(iterV + "=toIterator((int[])" + itemsV + ");"); - // long[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof long[])"); - ctxt.generateJavaSource(iterV + "=toIterator((long[])" + itemsV + ");"); - // float[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof float[])"); - ctxt.generateJavaSource(iterV + "=toIterator((float[])" + itemsV + ");"); - // double[] - ctxt.generateJavaSource("else if (" + itemsV + " instanceof double[])"); - ctxt.generateJavaSource(iterV + "=toIterator((double[])" + itemsV + ");"); - - // Collection - ctxt.generateJavaSource("else if (" + itemsV + " instanceof Collection)"); - ctxt.generateJavaSource(iterV + "=((Collection)" + itemsV + ").iterator();"); - - // Iterator - ctxt.generateJavaSource("else if (" + itemsV + " instanceof Iterator)"); - ctxt.generateJavaSource(iterV + "=(Iterator)" + itemsV + ";"); - - // Enumeration - ctxt.generateJavaSource("else if (" + itemsV + " instanceof Enumeration)"); - ctxt.generateJavaSource(iterV + "=toIterator((Enumeration)" + itemsV + ");"); - - // Map - ctxt.generateJavaSource("else if (" + itemsV + " instanceof Map)"); - ctxt.generateJavaSource(iterV + "=((Map)" + itemsV + ").entrySet().iterator();"); - - if (hasBegin) { - String tV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("for (int " + tV + "=" + beginV + ";" + - tV + ">0 && " + iterV + ".hasNext(); " + - tV + "--)"); - ctxt.generateJavaSource(iterV + ".next();"); - } - - ctxt.generateJavaSource("while (" + iterV + ".hasNext()){"); - if (hasVar) { - ctxt.generateJavaSource("_jspx_page_context.setAttribute("); - ctxt.generateAttribute("var"); - ctxt.generateJavaSource(", " + iterV + ".next());"); - } - - ctxt.generateBody(); - - if (hasStep) { - String tV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("for (int " + tV + "=" + stepV + "-1;" + - tV + ">0 && " + iterV + ".hasNext(); " + - tV + "--)"); - ctxt.generateJavaSource(iterV + ".next();"); - } - if (hasEnd) { - if (hasStep) { - ctxt.generateJavaSource(indexV + "+=" + stepV + ";"); - } - else { - ctxt.generateJavaSource(indexV + "++;"); - } - if (hasBegin) { - ctxt.generateJavaSource("if(" + beginV + "+" + indexV + - ">"+ endV + ")"); - } - else { - ctxt.generateJavaSource("if(" + indexV + ">" + endV + ")"); - } - ctxt.generateJavaSource("break;"); - } - ctxt.generateJavaSource("}"); // while - } - - /** - * Generate iterators for data types supported in items - */ - private void generateIterators(TagPluginContext ctxt) { - - // Object[] - ctxt.generateDeclaration("ObjectArrayIterator", - "private Iterator toIterator(final Object[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return a[index++];}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // boolean[] - ctxt.generateDeclaration("booleanArrayIterator", - "private Iterator toIterator(final boolean[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Boolean(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // byte[] - ctxt.generateDeclaration("byteArrayIterator", - "private Iterator toIterator(final byte[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Byte(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // char[] - ctxt.generateDeclaration("charArrayIterator", - "private Iterator toIterator(final char[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Character(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // short[] - ctxt.generateDeclaration("shortArrayIterator", - "private Iterator toIterator(final short[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Short(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // int[] - ctxt.generateDeclaration("intArrayIterator", - "private Iterator toIterator(final int[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Integer(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // long[] - ctxt.generateDeclaration("longArrayIterator", - "private Iterator toIterator(final long[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Long(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // float[] - ctxt.generateDeclaration("floatArrayIterator", - "private Iterator toIterator(final float[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Float(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // double[] - ctxt.generateDeclaration("doubleArrayIterator", - "private Iterator toIterator(final double[] a){\n" + - " return (new Iterator() {\n" + - " int index=0;\n" + - " public boolean hasNext() {\n" + - " return index < a.length;}\n" + - " public Object next() {\n" + - " return new Double(a[index++]);}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - // Enumeration - ctxt.generateDeclaration("enumIterator", - "private Iterator toIterator(final Enumeration e){\n" + - " return (new Iterator() {\n" + - " public boolean hasNext() {\n" + - " return e.hasMoreElements();}\n" + - " public Object next() {\n" + - " return e.nextElement();}\n" + - " public void remove() {}\n" + - " });\n" + - "}" - ); - - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/ForTokens.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/ForTokens.java deleted file mode 100644 index c72f0ad21..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/ForTokens.java +++ /dev/null @@ -1,119 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; - -public class ForTokens implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - boolean hasVar, hasVarStatus, hasBegin, hasEnd, hasStep; - - //init the flags - hasVar = ctxt.isAttributeSpecified("var"); - hasVarStatus = ctxt.isAttributeSpecified("varStatus"); - hasBegin = ctxt.isAttributeSpecified("begin"); - hasEnd = ctxt.isAttributeSpecified("end"); - hasStep = ctxt.isAttributeSpecified("step"); - - if(hasVarStatus){ - ctxt.dontUseTagPlugin(); - return; - } - - //define all the temp variables' names - String itemsName = ctxt.getTemporaryVariableName(); - String delimsName = ctxt.getTemporaryVariableName(); - String stName = ctxt.getTemporaryVariableName(); - String beginName = ctxt.getTemporaryVariableName(); - String endName = ctxt.getTemporaryVariableName(); - String stepName = ctxt.getTemporaryVariableName(); - String index = ctxt.getTemporaryVariableName(); - String temp = ctxt.getTemporaryVariableName(); - String tokensCountName = ctxt.getTemporaryVariableName(); - - //get the value of the "items" attribute - ctxt.generateJavaSource("String " + itemsName + " = (String)"); - ctxt.generateAttribute("items"); - ctxt.generateJavaSource(";"); - - //get the value of the "delim" attribute - ctxt.generateJavaSource("String " + delimsName + " = (String)"); - ctxt.generateAttribute("delims"); - ctxt.generateJavaSource(";"); - - //new a StringTokenizer Object according to the "items" and the "delim" - ctxt.generateJavaSource("java.util.StringTokenizer " + stName + " = " + - "new java.util.StringTokenizer(" + itemsName + ", " + delimsName + ");"); - - //if "begin" specified, move the token to the "begin" place - //and record the begin index. default begin place is 0. - ctxt.generateJavaSource("int " + tokensCountName + " = " + stName + ".countTokens();"); - if(hasBegin){ - ctxt.generateJavaSource("int " + beginName + " = " ); - ctxt.generateAttribute("begin"); - ctxt.generateJavaSource(";"); - ctxt.generateJavaSource("for(int " + index + " = 0; " + index + " < " + beginName + " && " + stName + ".hasMoreTokens(); " + index + "++, " + stName + ".nextToken()){}"); - }else{ - ctxt.generateJavaSource("int " + beginName + " = 0;"); - } - - //when "end" is specified, if the "end" is more than the last index, - //record the end place as the last index, otherwise, record it as "end"; - //default end place is the last index - if(hasEnd){ - ctxt.generateJavaSource("int " + endName + " = 0;" ); - ctxt.generateJavaSource("if((" + tokensCountName + " - 1) < "); - ctxt.generateAttribute("end"); - ctxt.generateJavaSource("){"); - ctxt.generateJavaSource(" " + endName + " = " + tokensCountName + " - 1;"); - ctxt.generateJavaSource("}else{"); - ctxt.generateJavaSource(" " + endName + " = "); - ctxt.generateAttribute("end"); - ctxt.generateJavaSource(";}"); - }else{ - ctxt.generateJavaSource("int " + endName + " = " + tokensCountName + " - 1;"); - } - - //get the step value from "step" if specified. - //default step value is 1. - if(hasStep){ - ctxt.generateJavaSource("int " + stepName + " = " ); - ctxt.generateAttribute("step"); - ctxt.generateJavaSource(";"); - }else{ - ctxt.generateJavaSource("int " + stepName + " = 1;"); - } - - //the loop - ctxt.generateJavaSource("for(int " + index + " = " + beginName + "; " + index + " <= " + endName + "; " + index + "++){"); - ctxt.generateJavaSource(" String " + temp + " = " + stName + ".nextToken();"); - ctxt.generateJavaSource(" if(((" + index + " - " + beginName + ") % " + stepName + ") == 0){"); - //if var specified, put the current token into the attribute "var" defines. - if(hasVar){ - String strVar = ctxt.getConstantAttribute("var"); - ctxt.generateJavaSource(" pageContext.setAttribute(\"" + strVar + "\", " + temp + ");"); - } - ctxt.generateBody(); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource("}"); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/If.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/If.java deleted file mode 100644 index 5f5a6df44..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/If.java +++ /dev/null @@ -1,50 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.*; - -public final class If implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - String condV = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource("boolean " + condV + "="); - ctxt.generateAttribute("test"); - ctxt.generateJavaSource(";"); - if (ctxt.isAttributeSpecified("var")) { - String scope = "PageContext.PAGE_SCOPE"; - if (ctxt.isAttributeSpecified("scope")) { - String scopeStr = ctxt.getConstantAttribute("scope"); - if ("request".equals(scopeStr)) { - scope = "PageContext.REQUEST_SCOPE"; - } else if ("session".equals(scopeStr)) { - scope = "PageContext.SESSION_SCOPE"; - } else if ("application".equals(scopeStr)) { - scope = "PageContext.APPLICATION_SCOPE"; - } - } - ctxt.generateJavaSource("_jspx_page_context.setAttribute("); - ctxt.generateAttribute("var"); - ctxt.generateJavaSource(", new Boolean(" + condV + ")," + scope + ");"); - } - ctxt.generateJavaSource("if (" + condV + "){"); - ctxt.generateBody(); - ctxt.generateJavaSource("}"); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Import.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Import.java deleted file mode 100644 index 080342932..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Import.java +++ /dev/null @@ -1,382 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; -import org.apache.jasper.tagplugins.jstl.Util; - -public class Import implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - boolean hasContext, hasVar, hasScope, hasVarReader, hasCharEncoding; - - //flags - hasContext = ctxt.isAttributeSpecified("context"); - hasVar = ctxt.isAttributeSpecified("var"); - hasScope = ctxt.isAttributeSpecified("scope"); - hasVarReader = ctxt.isAttributeSpecified("varReader"); - hasCharEncoding = ctxt.isAttributeSpecified("charEncoding"); - - //variables' names - String urlName = ctxt.getTemporaryVariableName(); - String contextName = ctxt.getTemporaryVariableName(); - String iauName = ctxt.getTemporaryVariableName(); // is absolute url - String urlObjName = ctxt.getTemporaryVariableName(); //URL object - String ucName = ctxt.getTemporaryVariableName(); //URLConnection - String inputStreamName = ctxt.getTemporaryVariableName(); - String tempReaderName = ctxt.getTemporaryVariableName(); - String tempReaderName2 = ctxt.getTemporaryVariableName(); - String charSetName = ctxt.getTemporaryVariableName(); - String charEncodingName = ctxt.getTemporaryVariableName(); - String contentTypeName = ctxt.getTemporaryVariableName(); - String varReaderName = ctxt.getTemporaryVariableName(); - String servletContextName = ctxt.getTemporaryVariableName(); - String servletPathName = ctxt.getTemporaryVariableName(); - String requestDispatcherName = ctxt.getTemporaryVariableName(); - String irwName = ctxt.getTemporaryVariableName(); //ImportResponseWrapper name - String brName = ctxt.getTemporaryVariableName(); //BufferedReader name - String sbName = ctxt.getTemporaryVariableName(); //StringBuffer name - String tempStringName = ctxt.getTemporaryVariableName(); - - //is absolute url - ctxt.generateJavaSource("boolean " + iauName + ";"); - - //get the url value - ctxt.generateJavaSource("String " + urlName + " = "); - ctxt.generateAttribute("url"); - ctxt.generateJavaSource(";"); - - //validate the url - ctxt.generateJavaSource("if(" + urlName + " == null || " + urlName + ".equals(\"\")){"); - ctxt.generateJavaSource(" throw new JspTagException(\"The \\\"url\\\" attribute " + - "illegally evaluated to \\\"null\\\" or \\\"\\\" in <import>\");"); - ctxt.generateJavaSource("}"); - - //initialize the is_absolute_url - ctxt.generateJavaSource(iauName + " = " + - "org.apache.jasper.tagplugins.jstl.Util.isAbsoluteUrl(" + urlName + ");"); - - //validate the context - if(hasContext){ - - ctxt.generateJavaSource("String " + contextName + " = "); - ctxt.generateAttribute("context"); - ctxt.generateJavaSource(";"); - - ctxt.generateJavaSource("if((!" + contextName + ".startsWith(\"/\")) " + - "|| (!" + urlName + ".startsWith(\"/\"))){"); - ctxt.generateJavaSource(" throw new JspTagException" + - "(\"In URL tags, when the \\\"context\\\" attribute is specified, " + - "values of both \\\"context\\\" and \\\"url\\\" must start with \\\"/\\\".\");"); - ctxt.generateJavaSource("}"); - - } - - //define charset - ctxt.generateJavaSource("String " + charSetName + " = null;"); - - //if the charEncoding attribute is specified - if(hasCharEncoding){ - - //initialize the charEncoding - ctxt.generateJavaSource("String " + charEncodingName + " = "); - ctxt.generateAttribute("charEncoding"); - ctxt.generateJavaSource(";"); - - //assign appropriate value tp the charset - ctxt.generateJavaSource("if(null != " + charEncodingName + " " + - "&& !" + charEncodingName + ".equals(\"\")){"); - ctxt.generateJavaSource(" " + charSetName + " = " - + charEncodingName + ";"); - ctxt.generateJavaSource("}"); - } - - //reshape the url string - ctxt.generateJavaSource("if(!"+iauName+"){"); - ctxt.generateJavaSource(" if(!" + urlName + ".startsWith(\"/\")){"); - ctxt.generateJavaSource(" String " + servletPathName + " = " + - "((HttpServletRequest)pageContext.getRequest()).getServletPath();"); - ctxt.generateJavaSource(" " + urlName + " = " - + servletPathName + ".substring(0," + servletPathName + ".lastIndexOf('/')) + '/' + " + urlName + ";"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource("}"); - - //if the varReader attribute specified - if(hasVarReader){ - - //get the String value of varReader - ctxt.generateJavaSource("String " + varReaderName + " = "); - ctxt.generateAttribute("varReader"); - ctxt.generateJavaSource(";"); - - //if the url is absolute url - ctxt.generateJavaSource("if(" + iauName + "){"); - - //get the content of the target - ctxt.generateJavaSource(" java.net.URL " + urlObjName + " = new java.net.URL(" + urlName + ");"); - ctxt.generateJavaSource(" java.net.URLConnection " + ucName + " = " - + urlObjName + ".openConnection();"); - ctxt.generateJavaSource(" java.io.InputStream " + inputStreamName + " = " - + ucName + ".getInputStream();"); - - ctxt.generateJavaSource(" if(" + charSetName + " == null){"); - ctxt.generateJavaSource(" String " + contentTypeName + " = " - + ucName + ".getContentType();"); - ctxt.generateJavaSource(" if(null != " + contentTypeName + "){"); - ctxt.generateJavaSource(" " + charSetName + " = " + - "org.apache.jasper.tagplugins.jstl.Util.getContentTypeAttribute(" + contentTypeName + ", \"charset\");"); - ctxt.generateJavaSource(" if(" + charSetName + " == null) " - + charSetName + " = org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING;"); - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" " + charSetName + " = org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING;"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" }"); - - if(!hasCharEncoding){ - ctxt.generateJavaSource(" String " + contentTypeName + " = " + ucName + ".getContentType();"); - } - - //define the Reader - ctxt.generateJavaSource(" java.io.Reader " + tempReaderName + " = null;"); - - //initialize the Reader object - ctxt.generateJavaSource(" try{"); - ctxt.generateJavaSource(" " + tempReaderName + " = new java.io.InputStreamReader(" + inputStreamName + ", " + charSetName + ");"); - ctxt.generateJavaSource(" }catch(Exception ex){"); - ctxt.generateJavaSource(" " + tempReaderName + " = new java.io.InputStreamReader(" + inputStreamName + ", org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING);"); - ctxt.generateJavaSource(" }"); - - //validate the response - ctxt.generateJavaSource(" if(" + ucName + " instanceof java.net.HttpURLConnection){"); - ctxt.generateJavaSource(" int status = ((java.net.HttpURLConnection) " + ucName + ").getResponseCode();"); - ctxt.generateJavaSource(" if(status < 200 || status > 299){"); - ctxt.generateJavaSource(" throw new JspTagException(status + \" \" + " + urlName + ");"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" }"); - - //set attribute in the page context scope - ctxt.generateJavaSource(" pageContext.setAttribute(" + varReaderName + ", " + tempReaderName + ");"); - - //if the url is relative - ctxt.generateJavaSource("}else{"); - - //if the url is relative, http request is needed - ctxt.generateJavaSource(" if (!(pageContext.getRequest() instanceof HttpServletRequest " + - "&& pageContext.getResponse() instanceof HttpServletResponse)){"); - ctxt.generateJavaSource(" throw new JspTagException(\"Relative <import> from non-HTTP request not allowed\");"); - ctxt.generateJavaSource(" }"); - - //get the servlet context of the context defined in the context attribute - ctxt.generateJavaSource(" ServletContext " + servletContextName + " = null;"); - if(hasContext){ - ctxt.generateJavaSource(" if(null != " + contextName + "){"); - ctxt.generateJavaSource(" " + servletContextName + " = pageContext.getServletContext().getContext(" + contextName + ");" ); - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" " + servletContextName + " = pageContext.getServletContext();"); - ctxt.generateJavaSource(" }"); - }else{ - ctxt.generateJavaSource(" " + servletContextName + " = pageContext.getServletContext();"); - } - - // - ctxt.generateJavaSource(" if(" + servletContextName + " == null){"); - if(hasContext){ - ctxt.generateJavaSource(" throw new JspTagException(\"Unable to get RequestDispatcher for Context: \\\" \"+" + contextName + "+\" \\\" and URL: \\\" \" +" + urlName + "+ \" \\\". Verify values and/or enable cross context access.\");"); - }else{ - ctxt.generateJavaSource(" throw new JspTagException(\"Unable to get RequestDispatcher for URL: \\\" \" +" + urlName + "+ \" \\\". Verify values and/or enable cross context access.\");"); - } - ctxt.generateJavaSource(" }"); - - //get the request dispatcher - ctxt.generateJavaSource(" RequestDispatcher " + requestDispatcherName + " = " + servletContextName + ".getRequestDispatcher(org.apache.jasper.tagplugins.jstl.Util.stripSession("+urlName+"));"); - ctxt.generateJavaSource(" if(" + requestDispatcherName + " == null) throw new JspTagException(org.apache.jasper.tagplugins.jstl.Util.stripSession("+urlName+"));"); - - //initialize a ImportResponseWrapper to include the resource - ctxt.generateJavaSource(" org.apache.jasper.tagplugins.jstl.Util.ImportResponseWrapper " + irwName + " = new org.apache.jasper.tagplugins.jstl.Util.ImportResponseWrapper((HttpServletResponse) pageContext.getResponse());"); - ctxt.generateJavaSource(" if(" + charSetName + " == null){"); - ctxt.generateJavaSource(" " + charSetName + " = org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING;"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" " + irwName + ".setCharEncoding(" + charSetName + ");"); - ctxt.generateJavaSource(" try{"); - ctxt.generateJavaSource(" " + requestDispatcherName + ".include(pageContext.getRequest(), " + irwName + ");"); - ctxt.generateJavaSource(" }catch(java.io.IOException ex){"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" }catch(RuntimeException ex){"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" }catch(ServletException ex){"); - ctxt.generateJavaSource(" Throwable rc = ex.getRootCause();"); - ctxt.generateJavaSource(" if (rc == null)"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" else"); - ctxt.generateJavaSource(" throw new JspException(rc);"); - ctxt.generateJavaSource(" }"); - - //validate the response status - ctxt.generateJavaSource(" if(" + irwName + ".getStatus() < 200 || " + irwName + ".getStatus() > 299){"); - ctxt.generateJavaSource(" throw new JspTagException(" + irwName + ".getStatus()+\" \" + org.apache.jasper.tagplugins.jstl.Util.stripSession(" + urlName + "));"); - ctxt.generateJavaSource(" }"); - - //push in the page context - ctxt.generateJavaSource(" java.io.Reader " + tempReaderName + " = new java.io.StringReader(" + irwName + ".getString());"); - ctxt.generateJavaSource(" pageContext.setAttribute(" + varReaderName + ", " + tempReaderName + ");"); - - ctxt.generateJavaSource("}"); - - //execute the body action - ctxt.generateBody(); - - //close the reader - ctxt.generateJavaSource("java.io.Reader " + tempReaderName2 + " = (java.io.Reader)pageContext.getAttribute(" + varReaderName + ");"); - ctxt.generateJavaSource("if(" + tempReaderName2 + " != null) " + tempReaderName2 + ".close();"); - ctxt.generateJavaSource("pageContext.removeAttribute(" + varReaderName + ",1);"); - } - - //if the varReader is not specified - else{ - - ctxt.generateJavaSource("pageContext.setAttribute(\"url_without_param\"," + urlName + ");"); - ctxt.generateBody(); - ctxt.generateJavaSource(urlName + " = (String)pageContext.getAttribute(\"url_without_param\");"); - ctxt.generateJavaSource("pageContext.removeAttribute(\"url_without_param\");"); - String strScope = "page"; - if(hasScope){ - strScope = ctxt.getConstantAttribute("scope"); - } - int iScope = Util.getScope(strScope); - - ctxt.generateJavaSource("String " + tempStringName + " = null;"); - - ctxt.generateJavaSource("if(" + iauName + "){"); - - //get the content of the target - ctxt.generateJavaSource(" java.net.URL " + urlObjName + " = new java.net.URL(" + urlName + ");"); - ctxt.generateJavaSource(" java.net.URLConnection " + ucName + " = " + urlObjName + ".openConnection();"); - ctxt.generateJavaSource(" java.io.InputStream " + inputStreamName + " = " + ucName + ".getInputStream();"); - ctxt.generateJavaSource(" java.io.Reader " + tempReaderName + " = null;"); - - ctxt.generateJavaSource(" if(" + charSetName + " == null){"); - ctxt.generateJavaSource(" String " + contentTypeName + " = " - + ucName + ".getContentType();"); - ctxt.generateJavaSource(" if(null != " + contentTypeName + "){"); - ctxt.generateJavaSource(" " + charSetName + " = " + - "org.apache.jasper.tagplugins.jstl.Util.getContentTypeAttribute(" + contentTypeName + ", \"charset\");"); - ctxt.generateJavaSource(" if(" + charSetName + " == null) " - + charSetName + " = org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING;"); - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" " + charSetName + " = org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING;"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" }"); - - ctxt.generateJavaSource(" try{"); - ctxt.generateJavaSource(" " + tempReaderName + " = new java.io.InputStreamReader(" + inputStreamName + "," + charSetName + ");"); - ctxt.generateJavaSource(" }catch(Exception ex){"); - //ctxt.generateJavaSource(" throw new JspTagException(ex.toString());"); - ctxt.generateJavaSource(" " + tempReaderName + " = new java.io.InputStreamReader(" + inputStreamName + ",org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING);"); - ctxt.generateJavaSource(" }"); - - //validate the response - ctxt.generateJavaSource(" if(" + ucName + " instanceof java.net.HttpURLConnection){"); - ctxt.generateJavaSource(" int status = ((java.net.HttpURLConnection) " + ucName + ").getResponseCode();"); - ctxt.generateJavaSource(" if(status < 200 || status > 299){"); - ctxt.generateJavaSource(" throw new JspTagException(status + \" \" + " + urlName + ");"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" }"); - - ctxt.generateJavaSource(" java.io.BufferedReader " + brName + " = new java.io.BufferedReader(" + tempReaderName + ");"); - ctxt.generateJavaSource(" StringBuffer " + sbName + " = new StringBuffer();"); - String index = ctxt.getTemporaryVariableName(); - ctxt.generateJavaSource(" int " + index + ";"); - ctxt.generateJavaSource(" while(("+index+" = "+brName+".read()) != -1) "+sbName+".append((char)"+index+");"); - ctxt.generateJavaSource(" " + tempStringName + " = " +sbName + ".toString();"); - - ctxt.generateJavaSource("}else{"); - - //if the url is relative, http request is needed. - ctxt.generateJavaSource(" if (!(pageContext.getRequest() instanceof HttpServletRequest " + - "&& pageContext.getResponse() instanceof HttpServletResponse)){"); - ctxt.generateJavaSource(" throw new JspTagException(\"Relative <import> from non-HTTP request not allowed\");"); - ctxt.generateJavaSource(" }"); - - //get the servlet context of the context defined in the context attribute - ctxt.generateJavaSource(" ServletContext " + servletContextName + " = null;"); - if(hasContext){ - ctxt.generateJavaSource(" if(null != " + contextName + "){"); - ctxt.generateJavaSource(" " + servletContextName + " = pageContext.getServletContext().getContext(" + contextName + ");" ); - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" " + servletContextName + " = pageContext.getServletContext();"); - ctxt.generateJavaSource(" }"); - }else{ - ctxt.generateJavaSource(" " + servletContextName + " = pageContext.getServletContext();"); - } - - // - ctxt.generateJavaSource(" if(" + servletContextName + " == null){"); - if(hasContext){ - ctxt.generateJavaSource(" throw new JspTagException(\"Unable to get RequestDispatcher for Context: \\\" \" +" + contextName + "+ \" \\\" and URL: \\\" \" +" + urlName + "+ \" \\\". Verify values and/or enable cross context access.\");"); - }else{ - ctxt.generateJavaSource(" throw new JspTagException(\"Unable to get RequestDispatcher for URL: \\\" \" +" + urlName + "+ \" \\\". Verify values and/or enable cross context access.\");"); - } - ctxt.generateJavaSource(" }"); - - //get the request dispatcher - ctxt.generateJavaSource(" RequestDispatcher " + requestDispatcherName + " = " + servletContextName + ".getRequestDispatcher(org.apache.jasper.tagplugins.jstl.Util.stripSession("+urlName+"));"); - ctxt.generateJavaSource(" if(" + requestDispatcherName + " == null) throw new JspTagException(org.apache.jasper.tagplugins.jstl.Util.stripSession("+urlName+"));"); - - //initialize a ImportResponseWrapper to include the resource - ctxt.generateJavaSource(" org.apache.jasper.tagplugins.jstl.Util.ImportResponseWrapper " + irwName + " = new org.apache.jasper.tagplugins.jstl.Util.ImportResponseWrapper((HttpServletResponse) pageContext.getResponse());"); - ctxt.generateJavaSource(" if(" + charSetName + " == null){"); - ctxt.generateJavaSource(" " + charSetName + " = org.apache.jasper.tagplugins.jstl.Util.DEFAULT_ENCODING;"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" " + irwName + ".setCharEncoding(" + charSetName + ");"); - ctxt.generateJavaSource(" try{"); - ctxt.generateJavaSource(" " + requestDispatcherName + ".include(pageContext.getRequest(), " + irwName + ");"); - ctxt.generateJavaSource(" }catch(java.io.IOException ex){"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" }catch(RuntimeException ex){"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" }catch(ServletException ex){"); - ctxt.generateJavaSource(" Throwable rc = ex.getRootCause();"); - ctxt.generateJavaSource(" if (rc == null)"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" else"); - ctxt.generateJavaSource(" throw new JspException(rc);"); - ctxt.generateJavaSource(" }"); - - //validate the response status - ctxt.generateJavaSource(" if(" + irwName + ".getStatus() < 200 || " + irwName + ".getStatus() > 299){"); - ctxt.generateJavaSource(" throw new JspTagException(" + irwName + ".getStatus()+\" \" + org.apache.jasper.tagplugins.jstl.Util.stripSession(" + urlName + "));"); - ctxt.generateJavaSource(" }"); - - ctxt.generateJavaSource(" " + tempStringName + " = " + irwName + ".getString();"); - - ctxt.generateJavaSource("}"); - - if(hasVar){ - String strVar = ctxt.getConstantAttribute("var"); - ctxt.generateJavaSource("pageContext.setAttribute(\""+strVar+"\"," + tempStringName + "," + iScope + ");"); - }else{ - ctxt.generateJavaSource("pageContext.getOut().print(" + tempStringName + ");"); - } - } - } - - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Otherwise.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Otherwise.java deleted file mode 100644 index 3119d3027..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Otherwise.java +++ /dev/null @@ -1,32 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.*; - -public final class Otherwise implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - // See When.java for the reason whey "}" is need at the beginng and - // not at the end. - ctxt.generateJavaSource("} else {"); - ctxt.generateBody(); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Out.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Out.java deleted file mode 100644 index 92ac1fe03..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Out.java +++ /dev/null @@ -1,90 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; - - -public final class Out implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - //these two data member are to indicate - //whether the corresponding attribute is specified - boolean hasDefault=false, hasEscapeXml=false; - hasDefault = ctxt.isAttributeSpecified("default"); - hasEscapeXml = ctxt.isAttributeSpecified("escapeXml"); - - //strValName, strEscapeXmlName & strDefName are two variables' name - //standing for value, escapeXml and default attribute - String strValName = ctxt.getTemporaryVariableName(); - String strDefName = ctxt.getTemporaryVariableName(); - String strEscapeXmlName = ctxt.getTemporaryVariableName(); - - //according to the tag file, the value attribute is mandatory. - ctxt.generateJavaSource("String " + strValName + " = null;"); - ctxt.generateJavaSource("if("); - ctxt.generateAttribute("value"); - ctxt.generateJavaSource("!=null){"); - ctxt.generateJavaSource(" " + strValName + " = ("); - ctxt.generateAttribute("value"); - ctxt.generateJavaSource(").toString();"); - ctxt.generateJavaSource("}"); - - //initiate the strDefName with null. - //if the default has been specified, then assign the value to it; - ctxt.generateJavaSource("String " + strDefName + " = null;\n"); - if(hasDefault){ - ctxt.generateJavaSource("if("); - ctxt.generateAttribute("default"); - ctxt.generateJavaSource(" != null){"); - ctxt.generateJavaSource(strDefName + " = ("); - ctxt.generateAttribute("default"); - ctxt.generateJavaSource(").toString();"); - ctxt.generateJavaSource("}"); - } - - //initiate the strEscapeXmlName with true; - //if the escapeXml is specified, assign the value to it; - ctxt.generateJavaSource("boolean " + strEscapeXmlName + " = true;"); - if(hasEscapeXml){ - ctxt.generateJavaSource(strEscapeXmlName + " = Boolean.parseBoolean(("); - ctxt.generateAttribute("default"); - ctxt.generateJavaSource(").toString());"); - } - - //main part. - ctxt.generateJavaSource("if(null != " + strValName +"){"); - ctxt.generateJavaSource(" if(" + strEscapeXmlName + "){"); - ctxt.generateJavaSource(" " + strValName + " = org.apache.jasper.tagplugins.jstl.Util.escapeXml(" + strValName + ");"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" out.write(" + strValName + ");"); - ctxt.generateJavaSource("}else{"); - ctxt.generateJavaSource(" if(null != " + strDefName + "){"); - ctxt.generateJavaSource(" if(" + strEscapeXmlName + "){"); - ctxt.generateJavaSource(" " + strDefName + " = org.apache.jasper.tagplugins.jstl.Util.escapeXml(" + strDefName + ");"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" out.write(" + strDefName + ");"); - ctxt.generateJavaSource(" }else{"); - ctxt.generateBody(); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource("}"); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Param.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Param.java deleted file mode 100644 index 42256b869..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Param.java +++ /dev/null @@ -1,77 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; - -public class Param implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - //don't support the body content - - //define names of all the temp variables - String nameName = ctxt.getTemporaryVariableName(); - String valueName = ctxt.getTemporaryVariableName(); - String urlName = ctxt.getTemporaryVariableName(); - String encName = ctxt.getTemporaryVariableName(); - String index = ctxt.getTemporaryVariableName(); - - //if the param tag has no parents, throw a exception - TagPluginContext parent = ctxt.getParentContext(); - if(parent == null){ - ctxt.generateJavaSource(" throw new JspTagExcption" + - "(\"<param> outside <import> or <urlEncode>\");"); - return; - } - - //get the url string before adding this param - ctxt.generateJavaSource("String " + urlName + " = " + - "(String)pageContext.getAttribute(\"url_without_param\");"); - - //get the value of "name" - ctxt.generateJavaSource("String " + nameName + " = "); - ctxt.generateAttribute("name"); - ctxt.generateJavaSource(";"); - - //if the "name" is null then do nothing. - //else add such string "name=value" to the url. - //and the url should be encoded - ctxt.generateJavaSource("if(" + nameName + " != null && !" + nameName + ".equals(\"\")){"); - ctxt.generateJavaSource(" String " + valueName + " = "); - ctxt.generateAttribute("value"); - ctxt.generateJavaSource(";"); - ctxt.generateJavaSource(" if(" + valueName + " == null) " + valueName + " = \"\";"); - ctxt.generateJavaSource(" String " + encName + " = pageContext.getResponse().getCharacterEncoding();"); - ctxt.generateJavaSource(" " + nameName + " = java.net.URLEncoder.encode(" + nameName + ", " + encName + ");"); - ctxt.generateJavaSource(" " + valueName + " = java.net.URLEncoder.encode(" + valueName + ", " + encName + ");"); - ctxt.generateJavaSource(" int " + index + ";"); - ctxt.generateJavaSource(" " + index + " = " + urlName + ".indexOf(\'?\');"); - //if the current param is the first one, add a "?" ahead of it - //else add a "&" ahead of it - ctxt.generateJavaSource(" if(" + index + " == -1){"); - ctxt.generateJavaSource(" " + urlName + " = " + urlName + " + \"?\" + " + nameName + " + \"=\" + " + valueName + ";"); - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" " + urlName + " = " + urlName + " + \"&\" + " + nameName + " + \"=\" + " + valueName + ";"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" pageContext.setAttribute(\"url_without_param\"," + urlName + ");"); - ctxt.generateJavaSource("}"); - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Redirect.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Redirect.java deleted file mode 100644 index 6a5813fb8..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Redirect.java +++ /dev/null @@ -1,83 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; - -public class Redirect implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - //flag for the existence of the "context" - boolean hasContext = ctxt.isAttributeSpecified("context"); - - //names of the temp variables - String urlName = ctxt.getTemporaryVariableName(); - String contextName = ctxt.getTemporaryVariableName(); - String baseUrlName = ctxt.getTemporaryVariableName(); - String resultName = ctxt.getTemporaryVariableName(); - String responseName = ctxt.getTemporaryVariableName(); - - //get context - ctxt.generateJavaSource("String " + contextName + " = null;"); - if(hasContext){ - ctxt.generateJavaSource(contextName + " = "); - ctxt.generateAttribute("context"); - ctxt.generateJavaSource(";"); - } - - //get the url - ctxt.generateJavaSource("String " + urlName + " = "); - ctxt.generateAttribute("url"); - ctxt.generateJavaSource(";"); - - //get the raw url according to "url" and "context" - ctxt.generateJavaSource("String " + baseUrlName + " = " + - "org.apache.jasper.tagplugins.jstl.Util.resolveUrl(" + urlName + ", " + contextName + ", pageContext);"); - ctxt.generateJavaSource("pageContext.setAttribute" + - "(\"url_without_param\", " + baseUrlName + ");"); - - //add params - ctxt.generateBody(); - - ctxt.generateJavaSource("String " + resultName + " = " + - "(String)pageContext.getAttribute(\"url_without_param\");"); - ctxt.generateJavaSource("pageContext.removeAttribute" + - "(\"url_without_param\");"); - - //get the response object - ctxt.generateJavaSource("HttpServletResponse " + responseName + " = " + - "((HttpServletResponse) pageContext.getResponse());"); - - //if the url is relative, encode it - ctxt.generateJavaSource("if(!org.apache.jasper.tagplugins.jstl.Util.isAbsoluteUrl(" + resultName + ")){"); - ctxt.generateJavaSource(" " + resultName + " = " - + responseName + ".encodeRedirectURL(" + resultName + ");"); - ctxt.generateJavaSource("}"); - - //do redirect - ctxt.generateJavaSource("try{"); - ctxt.generateJavaSource(" " + responseName + ".sendRedirect(" + resultName + ");"); - ctxt.generateJavaSource("}catch(java.io.IOException ex){"); - ctxt.generateJavaSource(" throw new JspTagException(ex.toString(), ex);"); - ctxt.generateJavaSource("}"); - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Remove.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Remove.java deleted file mode 100644 index f21fa8f49..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Remove.java +++ /dev/null @@ -1,45 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; -import org.apache.jasper.tagplugins.jstl.Util; - -public class Remove implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - //scope flag - boolean hasScope = ctxt.isAttributeSpecified("scope"); - - //the value of the "var" - String strVar = ctxt.getConstantAttribute("var"); - - //remove attribute from certain scope. - //default scope is "page". - if(hasScope){ - int iScope = Util.getScope(ctxt.getConstantAttribute("scope")); - ctxt.generateJavaSource("pageContext.removeAttribute(\"" + strVar + "\"," + iScope + ");"); - }else{ - ctxt.generateJavaSource("pageContext.removeAttribute(\"" + strVar + "\");"); - } - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Set.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Set.java deleted file mode 100644 index bfb2c8bf9..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Set.java +++ /dev/null @@ -1,167 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; -import org.apache.jasper.tagplugins.jstl.Util; - -public class Set implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - //the flags to indicate whether the attributes have been specified - boolean hasValue = false, hasVar = false, hasScope = false, - hasTarget = false; - - //the scope name - String strScope; - //the id of the scope - int iScope; - - //initialize the flags - hasValue = ctxt.isAttributeSpecified("value"); - hasVar = ctxt.isAttributeSpecified("var"); - hasScope = ctxt.isAttributeSpecified("scope"); - hasTarget = ctxt.isAttributeSpecified("target"); - - //the temp variables name - String resultName = ctxt.getTemporaryVariableName(); - String targetName = ctxt.getTemporaryVariableName(); - String propertyName = ctxt.getTemporaryVariableName(); - - //initialize the "result" which will be assigned to the var or target.property - ctxt.generateJavaSource("Object " + resultName + " = null;"); - if(hasValue){ - ctxt.generateJavaSource(resultName + " = "); - ctxt.generateAttribute("value"); - ctxt.generateJavaSource(";"); - }else{ - ctxt.dontUseTagPlugin(); - return; - } - - //initialize the strScope - if(hasScope){ - strScope = ctxt.getConstantAttribute("scope"); - }else{ - strScope = "page"; - } - - //get the iScope according to the strScope - iScope = Util.getScope(strScope); - - //if the attribute var has been specified then assign the result to the var; - if(hasVar){ - String strVar = ctxt.getConstantAttribute("var"); - ctxt.generateJavaSource("if(null != " + resultName + "){"); - ctxt.generateJavaSource(" pageContext.setAttribute(\"" + strVar + "\"," + resultName + "," + iScope + ");"); - ctxt.generateJavaSource("} else {"); - if(hasScope){ - ctxt.generateJavaSource(" pageContext.removeAttribute(\"" + strVar + "\"," + iScope + ");"); - }else{ - ctxt.generateJavaSource(" pageContext.removeAttribute(\"" + strVar + "\");"); - } - ctxt.generateJavaSource("}"); - - //else assign the result to the target.property - }else if(hasTarget){ - - //generate the temp variable name - String pdName = ctxt.getTemporaryVariableName(); - String successFlagName = ctxt.getTemporaryVariableName(); - String index = ctxt.getTemporaryVariableName(); - String methodName = ctxt.getTemporaryVariableName(); - - //initialize the property - ctxt.generateJavaSource("String " + propertyName + " = null;"); - ctxt.generateJavaSource("if("); - ctxt.generateAttribute("property"); - ctxt.generateJavaSource(" != null){"); - ctxt.generateJavaSource(" " + propertyName + " = ("); - ctxt.generateAttribute("property"); - ctxt.generateJavaSource(").toString();"); - ctxt.generateJavaSource("}"); - - //initialize the target - ctxt.generateJavaSource("Object " + targetName + " = "); - ctxt.generateAttribute("target"); - ctxt.generateJavaSource(";"); - - //the target is ok - ctxt.generateJavaSource("if(" + targetName + " != null){"); - - //if the target is a map, then put the result into the map with the key property - ctxt.generateJavaSource(" if(" + targetName + " instanceof java.util.Map){"); - ctxt.generateJavaSource(" if(null != " + resultName + "){"); - ctxt.generateJavaSource(" ((java.util.Map) " + targetName + ").put(" + propertyName + "," + resultName + ");"); - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" ((java.util.Map) " + targetName + ").remove(" + propertyName + ");"); - ctxt.generateJavaSource(" }"); - - //else assign the result to the target.property - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" try{"); - - //get all the property of the target - ctxt.generateJavaSource(" java.beans.PropertyDescriptor " + pdName + "[] = java.beans.Introspector.getBeanInfo(" + targetName + ".getClass()).getPropertyDescriptors();"); - - //the success flag is to imply whether the assign is successful - ctxt.generateJavaSource(" boolean " + successFlagName + " = false;"); - - //find the right property - ctxt.generateJavaSource(" for(int " + index + "=0;" + index + "<" + pdName + ".length;" + index + "++){"); - ctxt.generateJavaSource(" if(" + pdName + "[" + index + "].getName().equals(" + propertyName + ")){"); - - //get the "set" method; - ctxt.generateJavaSource(" java.lang.reflect.Method " + methodName + " = " + pdName + "[" + index + "].getWriteMethod();"); - ctxt.generateJavaSource(" if(null == " + methodName + "){"); - ctxt.generateJavaSource(" throw new JspException(\"No setter method in <set> for property \"+" + propertyName + ");"); - ctxt.generateJavaSource(" }"); - - //invoke the method through the reflection - ctxt.generateJavaSource(" if(" + resultName + " != null){"); - ctxt.generateJavaSource(" " + methodName + ".invoke(" + targetName + ", new Object[]{(" + methodName + ".getParameterTypes()[0]).cast(" + resultName + ")});"); - ctxt.generateJavaSource(" }else{"); - ctxt.generateJavaSource(" " + methodName + ".invoke(" + targetName + ", new Object[]{null});"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" " + successFlagName + " = true;"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" if(!" + successFlagName + "){"); - ctxt.generateJavaSource(" throw new JspException(\"Invalid property in <set>:\"+" + propertyName + ");"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" }"); - - //catch the el exception and throw it as a JspException - ctxt.generateJavaSource(" catch (IllegalAccessException ex) {"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" } catch (java.beans.IntrospectionException ex) {"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" } catch (java.lang.reflect.InvocationTargetException ex) {"); - ctxt.generateJavaSource(" throw new JspException(ex);"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource(" }"); - ctxt.generateJavaSource("}else{"); - ctxt.generateJavaSource(" throw new JspException();"); - ctxt.generateJavaSource("}"); - } - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Url.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Url.java deleted file mode 100644 index 9db64f64a..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/Url.java +++ /dev/null @@ -1,101 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.TagPlugin; -import org.apache.jasper.compiler.tagplugin.TagPluginContext; -import org.apache.jasper.tagplugins.jstl.Util; - -public class Url implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - - //flags - boolean hasVar, hasContext, hasScope; - - //init flags - hasVar = ctxt.isAttributeSpecified("var"); - hasContext = ctxt.isAttributeSpecified("context"); - hasScope = ctxt.isAttributeSpecified("scope"); - - //define name of the temp variables - String valueName = ctxt.getTemporaryVariableName(); - String contextName = ctxt.getTemporaryVariableName(); - String baseUrlName = ctxt.getTemporaryVariableName(); - String resultName = ctxt.getTemporaryVariableName(); - String responseName = ctxt.getTemporaryVariableName(); - - //get the scope - String strScope = "page"; - if(hasScope){ - strScope = ctxt.getConstantAttribute("scope"); - } - int iScope = Util.getScope(strScope); - - //get the value - ctxt.generateJavaSource("String " + valueName + " = "); - ctxt.generateAttribute("value"); - ctxt.generateJavaSource(";"); - - //get the context - ctxt.generateJavaSource("String " + contextName + " = null;"); - if(hasContext){ - ctxt.generateJavaSource(contextName + " = "); - ctxt.generateAttribute("context"); - ctxt.generateJavaSource(";"); - } - - //get the raw url - ctxt.generateJavaSource("String " + baseUrlName + " = " + - "org.apache.jasper.tagplugins.jstl.Util.resolveUrl(" + valueName + ", " + contextName + ", pageContext);"); - ctxt.generateJavaSource("pageContext.setAttribute" + - "(\"url_without_param\", " + baseUrlName + ");"); - - //add params - ctxt.generateBody(); - - ctxt.generateJavaSource("String " + resultName + " = " + - "(String)pageContext.getAttribute(\"url_without_param\");"); - ctxt.generateJavaSource("pageContext.removeAttribute(\"url_without_param\");"); - - //if the url is relative, encode it - ctxt.generateJavaSource("if(!org.apache.jasper.tagplugins.jstl.Util.isAbsoluteUrl(" + resultName + ")){"); - ctxt.generateJavaSource(" HttpServletResponse " + responseName + " = " + - "((HttpServletResponse) pageContext.getResponse());"); - ctxt.generateJavaSource(" " + resultName + " = " - + responseName + ".encodeURL(" + resultName + ");"); - ctxt.generateJavaSource("}"); - - //if "var" is specified, the url string store in the attribute var defines - if(hasVar){ - String strVar = ctxt.getConstantAttribute("var"); - ctxt.generateJavaSource("pageContext.setAttribute" + - "(\"" + strVar + "\", " + resultName + ", " + iScope + ");"); - - //if var is not specified, just print out the url string - }else{ - ctxt.generateJavaSource("try{"); - ctxt.generateJavaSource(" pageContext.getOut().print(" + resultName + ");"); - ctxt.generateJavaSource("}catch(java.io.IOException ex){"); - ctxt.generateJavaSource(" throw new JspTagException(ex.toString(), ex);"); - ctxt.generateJavaSource("}"); - } - } - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/When.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/When.java deleted file mode 100644 index 10aefc8f1..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/core/When.java +++ /dev/null @@ -1,50 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.tagplugins.jstl.core; - -import org.apache.jasper.compiler.tagplugin.*; - -public final class When implements TagPlugin { - - public void doTag(TagPluginContext ctxt) { - // Get the parent context to determine if this is the first - TagPluginContext parentContext = ctxt.getParentContext(); - if (parentContext == null) { - ctxt.dontUseTagPlugin(); - return; - } - - if ("true".equals(parentContext.getPluginAttribute("hasBeenHere"))) { - ctxt.generateJavaSource("} else if("); - // See comment below for the reason we generate the extra "}" here. - } - else { - ctxt.generateJavaSource("if("); - parentContext.setPluginAttribute("hasBeenHere", "true"); - } - ctxt.generateAttribute("test"); - ctxt.generateJavaSource("){"); - ctxt.generateBody(); - - // We don't generate the closing "}" for the "if" here because there - // may be whitespaces in between 's. Instead we delay - // generating it until the next or or - // - } -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/tagPlugins.xml b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/tagPlugins.xml deleted file mode 100644 index 859c6c88d..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/tagplugins/jstl/tagPlugins.xml +++ /dev/null @@ -1,63 +0,0 @@ - - - - - org.apache.taglibs.standard.tag.rt.core.IfTag - org.apache.jasper.tagplugins.jstl.core.If - - - org.apache.taglibs.standard.tag.common.core.ChooseTag - org.apache.jasper.tagplugins.jstl.core.Choose - - - org.apache.taglibs.standard.tag.rt.core.WhenTag - org.apache.jasper.tagplugins.jstl.core.When - - - org.apache.taglibs.standard.tag.common.core.OtherwiseTag - org.apache.jasper.tagplugins.jstl.core.Otherwise - - - org.apache.taglibs.standard.tag.rt.core.ForEachTag - org.apache.jasper.tagplugins.jstl.core.ForEach - - - org.apache.taglibs.standard.tag.rt.core.OutTag - org.apache.jasper.tagplugins.jstl.core.Out - - - org.apache.taglibs.standard.tag.rt.core.SetTag - org.apache.jasper.tagplugins.jstl.core.Set - - - org.apache.taglibs.standard.tag.common.core.RemoveTag - org.apache.jasper.tagplugins.jstl.core.Remove - - - org.apache.taglibs.standard.tag.common.core.CatchTag - org.apache.jasper.tagplugins.jstl.core.Catch - - - org.apache.taglibs.standard.tag.rt.core.ForTokensTag - org.apache.jasper.tagplugins.jstl.core.ForTokens - - - org.apache.taglibs.standard.tag.rt.core.ImportTag - org.apache.jasper.tagplugins.jstl.core.Import - - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/util/Enumerator.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/util/Enumerator.java deleted file mode 100644 index 657e32dd0..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/util/Enumerator.java +++ /dev/null @@ -1,176 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - - -package org.apache.jasper.util; - - -import java.util.Collection; -import java.util.Enumeration; -import java.util.Iterator; -import java.util.List; -import java.util.ArrayList; -import java.util.Map; -import java.util.NoSuchElementException; - - -/** - * Adapter class that wraps an Enumeration around a Java2 - * collection classes object Iterator so that existing APIs - * returning Enumerations can easily run on top of the new collections. - * Constructors are provided to easliy create such wrappers. - * - * @author Craig R. McClanahan - * @version $Revision: 467222 $ $Date: 2006-10-24 05:17:11 +0200 (Tue, 24 Oct 2006) $ - */ - -public final class Enumerator implements Enumeration { - - - // ----------------------------------------------------------- Constructors - - - /** - * Return an Enumeration over the values of the specified Collection. - * - * @param collection Collection whose values should be enumerated - */ - public Enumerator(Collection collection) { - - this(collection.iterator()); - - } - - - /** - * Return an Enumeration over the values of the specified Collection. - * - * @param collection Collection whose values should be enumerated - * @param clone true to clone iterator - */ - public Enumerator(Collection collection, boolean clone) { - - this(collection.iterator(), clone); - - } - - - /** - * Return an Enumeration over the values returned by the - * specified Iterator. - * - * @param iterator Iterator to be wrapped - */ - public Enumerator(Iterator iterator) { - - super(); - this.iterator = iterator; - - } - - - /** - * Return an Enumeration over the values returned by the - * specified Iterator. - * - * @param iterator Iterator to be wrapped - * @param clone true to clone iterator - */ - public Enumerator(Iterator iterator, boolean clone) { - - super(); - if (!clone) { - this.iterator = iterator; - } else { - List list = new ArrayList(); - while (iterator.hasNext()) { - list.add(iterator.next()); - } - this.iterator = list.iterator(); - } - - } - - - /** - * Return an Enumeration over the values of the specified Map. - * - * @param map Map whose values should be enumerated - */ - public Enumerator(Map map) { - - this(map.values().iterator()); - - } - - - /** - * Return an Enumeration over the values of the specified Map. - * - * @param map Map whose values should be enumerated - * @param clone true to clone iterator - */ - public Enumerator(Map map, boolean clone) { - - this(map.values().iterator(), clone); - - } - - - // ----------------------------------------------------- Instance Variables - - - /** - * The Iterator over which the Enumeration - * represented by this class actually operates. - */ - private Iterator iterator = null; - - - // --------------------------------------------------------- Public Methods - - - /** - * Tests if this enumeration contains more elements. - * - * @return true if and only if this enumeration object - * contains at least one more element to provide, false - * otherwise - */ - public boolean hasMoreElements() { - - return (iterator.hasNext()); - - } - - - /** - * Returns the next element of this enumeration if this enumeration - * has at least one more element to provide. - * - * @return the next element of this enumeration - * - * @exception NoSuchElementException if no more elements exist - */ - public Object nextElement() throws NoSuchElementException { - - return (iterator.next()); - - } - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/ASCIIReader.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/ASCIIReader.java deleted file mode 100644 index 3cdcc8e70..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/ASCIIReader.java +++ /dev/null @@ -1,204 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.xmlparser; - -import java.io.InputStream; -import java.io.IOException; -import java.io.Reader; -import org.apache.jasper.compiler.Localizer; - -/** - * A simple ASCII byte reader. This is an optimized reader for reading - * byte streams that only contain 7-bit ASCII characters. - * - * @author Andy Clark, IBM - * - * @version $Id: ASCIIReader.java 708125 2008-10-27 10:10:13Z markt $ - */ -public class ASCIIReader - extends Reader { - - // - // Constants - // - - /** Default byte buffer size (2048). */ - public static final int DEFAULT_BUFFER_SIZE = 2048; - - // - // Data - // - - /** Input stream. */ - protected InputStream fInputStream; - - /** Byte buffer. */ - protected byte[] fBuffer; - - // - // Constructors - // - - /** - * Constructs an ASCII reader from the specified input stream - * and buffer size. - * - * @param inputStream The input stream. - * @param size The initial buffer size. - */ - public ASCIIReader(InputStream inputStream, int size) { - fInputStream = inputStream; - fBuffer = new byte[size]; - } - - // - // Reader methods - // - - /** - * Read a single character. This method will block until a character is - * available, an I/O error occurs, or the end of the stream is reached. - * - *

Subclasses that intend to support efficient single-character input - * should override this method. - * - * @return The character read, as an integer in the range 0 to 127 - * (0x00-0x7f), or -1 if the end of the stream has - * been reached - * - * @exception IOException If an I/O error occurs - */ - public int read() throws IOException { - int b0 = fInputStream.read(); - if (b0 > 0x80) { - throw new IOException(Localizer.getMessage("jsp.error.xml.invalidASCII", - Integer.toString(b0))); - } - return b0; - } // read():int - - /** - * Read characters into a portion of an array. This method will block - * until some input is available, an I/O error occurs, or the end of the - * stream is reached. - * - * @param ch Destination buffer - * @param offset Offset at which to start storing characters - * @param length Maximum number of characters to read - * - * @return The number of characters read, or -1 if the end of the - * stream has been reached - * - * @exception IOException If an I/O error occurs - */ - public int read(char ch[], int offset, int length) throws IOException { - if (length > fBuffer.length) { - length = fBuffer.length; - } - int count = fInputStream.read(fBuffer, 0, length); - for (int i = 0; i < count; i++) { - int b0 = (0xff & fBuffer[i]); // Convert to unsigned - if (b0 > 0x80) { - throw new IOException(Localizer.getMessage("jsp.error.xml.invalidASCII", - Integer.toString(b0))); - } - ch[offset + i] = (char)b0; - } - return count; - } // read(char[],int,int) - - /** - * Skip characters. This method will block until some characters are - * available, an I/O error occurs, or the end of the stream is reached. - * - * @param n The number of characters to skip - * - * @return The number of characters actually skipped - * - * @exception IOException If an I/O error occurs - */ - public long skip(long n) throws IOException { - return fInputStream.skip(n); - } // skip(long):long - - /** - * Tell whether this stream is ready to be read. - * - * @return True if the next read() is guaranteed not to block for input, - * false otherwise. Note that returning false does not guarantee that the - * next read will block. - * - * @exception IOException If an I/O error occurs - */ - public boolean ready() throws IOException { - return false; - } // ready() - - /** - * Tell whether this stream supports the mark() operation. - */ - public boolean markSupported() { - return fInputStream.markSupported(); - } // markSupported() - - /** - * Mark the present position in the stream. Subsequent calls to reset() - * will attempt to reposition the stream to this point. Not all - * character-input streams support the mark() operation. - * - * @param readAheadLimit Limit on the number of characters that may be - * read while still preserving the mark. After - * reading this many characters, attempting to - * reset the stream may fail. - * - * @exception IOException If the stream does not support mark(), - * or if some other I/O error occurs - */ - public void mark(int readAheadLimit) throws IOException { - fInputStream.mark(readAheadLimit); - } // mark(int) - - /** - * Reset the stream. If the stream has been marked, then attempt to - * reposition it at the mark. If the stream has not been marked, then - * attempt to reset it in some way appropriate to the particular stream, - * for example by repositioning it to its starting point. Not all - * character-input streams support the reset() operation, and some support - * reset() without supporting mark(). - * - * @exception IOException If the stream has not been marked, - * or if the mark has been invalidated, - * or if the stream does not support reset(), - * or if some other I/O error occurs - */ - public void reset() throws IOException { - fInputStream.reset(); - } // reset() - - /** - * Close the stream. Once a stream has been closed, further read(), - * ready(), mark(), or reset() invocations will throw an IOException. - * Closing a previously-closed stream, however, has no effect. - * - * @exception IOException If an I/O error occurs - */ - public void close() throws IOException { - fInputStream.close(); - } // close() - -} // class ASCIIReader diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/EncodingMap.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/EncodingMap.java deleted file mode 100644 index c5bb061f3..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/EncodingMap.java +++ /dev/null @@ -1,1020 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - * ==================================================================== - * - * This software consists of voluntary contributions made by many - * individuals on behalf of the Apache Software Foundation and was - * originally based on software copyright (c) 1999, International - * Business Machines, Inc., http://www.apache.org. For more - * information on the Apache Software Foundation, please see - * . - */ - -package org.apache.jasper.xmlparser; - -import java.util.Hashtable; - -/** - * EncodingMap is a convenience class which handles conversions between - * IANA encoding names and Java encoding names, and vice versa. The - * encoding names used in XML instance documents must - * be the IANA encoding names specified or one of the aliases for those names - * which IANA defines. - *

- * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - * - *
- *

Common Name - *

- *

Use this name in XML files - *

- *

Name Type - *

- *

Xerces converts to this Java Encoder Name - *

8 bit Unicode - *

UTF-8 - *

- *

IANA - *

- *

UTF8 - *

ISO Latin 1 - *

ISO-8859-1 - *

- *

MIME - *

- *

ISO-8859-1 - *

ISO Latin 2 - *

ISO-8859-2 - *

- *

MIME - *

- *

ISO-8859-2 - *

ISO Latin 3 - *

ISO-8859-3 - *

- *

MIME - *

- *

ISO-8859-3 - *

ISO Latin 4 - *

ISO-8859-4 - *

- *

MIME - *

- *

ISO-8859-4 - *

ISO Latin Cyrillic - *

ISO-8859-5 - *

- *

MIME - *

- *

ISO-8859-5 - *

ISO Latin Arabic - *

ISO-8859-6 - *

- *

MIME - *

- *

ISO-8859-6 - *

ISO Latin Greek - *

ISO-8859-7 - *

- *

MIME - *

- *

ISO-8859-7 - *

ISO Latin Hebrew - *

ISO-8859-8 - *

- *

MIME - *

- *

ISO-8859-8 - *

ISO Latin 5 - *

ISO-8859-9 - *

- *

MIME - *

- *

ISO-8859-9 - *

EBCDIC: US - *

ebcdic-cp-us - *

- *

IANA - *

- *

cp037 - *

EBCDIC: Canada - *

ebcdic-cp-ca - *

- *

IANA - *

- *

cp037 - *

EBCDIC: Netherlands - *

ebcdic-cp-nl - *

- *

IANA - *

- *

cp037 - *

EBCDIC: Denmark - *

ebcdic-cp-dk - *

- *

IANA - *

- *

cp277 - *

EBCDIC: Norway - *

ebcdic-cp-no - *

- *

IANA - *

- *

cp277 - *

EBCDIC: Finland - *

ebcdic-cp-fi - *

- *

IANA - *

- *

cp278 - *

EBCDIC: Sweden - *

ebcdic-cp-se - *

- *

IANA - *

- *

cp278 - *

EBCDIC: Italy - *

ebcdic-cp-it - *

- *

IANA - *

- *

cp280 - *

EBCDIC: Spain, Latin America - *

ebcdic-cp-es - *

- *

IANA - *

- *

cp284 - *

EBCDIC: Great Britain - *

ebcdic-cp-gb - *

- *

IANA - *

- *

cp285 - *

EBCDIC: France - *

ebcdic-cp-fr - *

- *

IANA - *

- *

cp297 - *

EBCDIC: Arabic - *

ebcdic-cp-ar1 - *

- *

IANA - *

- *

cp420 - *

EBCDIC: Hebrew - *

ebcdic-cp-he - *

- *

IANA - *

- *

cp424 - *

EBCDIC: Switzerland - *

ebcdic-cp-ch - *

- *

IANA - *

- *

cp500 - *

EBCDIC: Roece - *

ebcdic-cp-roece - *

- *

IANA - *

- *

cp870 - *

EBCDIC: Yugoslavia - *

ebcdic-cp-yu - *

- *

IANA - *

- *

cp870 - *

EBCDIC: Iceland - *

ebcdic-cp-is - *

- *

IANA - *

- *

cp871 - *

EBCDIC: Urdu - *

ebcdic-cp-ar2 - *

- *

IANA - *

- *

cp918 - *

Chinese for PRC, mixed 1/2 byte - *

gb2312 - *

- *

MIME - *

- *

GB2312 - *

Extended Unix Code, packed for Japanese - *

euc-jp - *

- *

MIME - *

- *

eucjis - *

Japanese: iso-2022-jp - *

iso-2020-jp - *

- *

MIME - *

- *

JIS - *

Japanese: Shift JIS - *

Shift_JIS - *

- *

MIME - *

- *

SJIS - *

Chinese: Big5 - *

Big5 - *

- *

MIME - *

- *

Big5 - *

Extended Unix Code, packed for Korean - *

euc-kr - *

- *

MIME - *

- *

iso2022kr - *

Cyrillic - *

koi8-r - *

- *

MIME - *

- *

koi8-r - *

- * - * @author TAMURA Kent, IBM - * @author Andy Clark, IBM - * - * @version $Id: EncodingMap.java 467222 2006-10-24 03:17:11Z markt $ - */ -public class EncodingMap { - - // - // Data - // - - /** fIANA2JavaMap */ - protected final static Hashtable fIANA2JavaMap = new Hashtable(); - - /** fJava2IANAMap */ - protected final static Hashtable fJava2IANAMap = new Hashtable(); - - // - // Static initialization - // - - static { - - // add IANA to Java encoding mappings. - fIANA2JavaMap.put("BIG5", "Big5"); - fIANA2JavaMap.put("CSBIG5", "Big5"); - fIANA2JavaMap.put("CP037", "CP037"); - fIANA2JavaMap.put("IBM037", "CP037"); - fIANA2JavaMap.put("CSIBM037", "CP037"); - fIANA2JavaMap.put("EBCDIC-CP-US", "CP037"); - fIANA2JavaMap.put("EBCDIC-CP-CA", "CP037"); - fIANA2JavaMap.put("EBCDIC-CP-NL", "CP037"); - fIANA2JavaMap.put("EBCDIC-CP-WT", "CP037"); - fIANA2JavaMap.put("IBM273", "CP273"); - fIANA2JavaMap.put("CP273", "CP273"); - fIANA2JavaMap.put("CSIBM273", "CP273"); - fIANA2JavaMap.put("IBM277", "CP277"); - fIANA2JavaMap.put("CP277", "CP277"); - fIANA2JavaMap.put("CSIBM277", "CP277"); - fIANA2JavaMap.put("EBCDIC-CP-DK", "CP277"); - fIANA2JavaMap.put("EBCDIC-CP-NO", "CP277"); - fIANA2JavaMap.put("IBM278", "CP278"); - fIANA2JavaMap.put("CP278", "CP278"); - fIANA2JavaMap.put("CSIBM278", "CP278"); - fIANA2JavaMap.put("EBCDIC-CP-FI", "CP278"); - fIANA2JavaMap.put("EBCDIC-CP-SE", "CP278"); - fIANA2JavaMap.put("IBM280", "CP280"); - fIANA2JavaMap.put("CP280", "CP280"); - fIANA2JavaMap.put("CSIBM280", "CP280"); - fIANA2JavaMap.put("EBCDIC-CP-IT", "CP280"); - fIANA2JavaMap.put("IBM284", "CP284"); - fIANA2JavaMap.put("CP284", "CP284"); - fIANA2JavaMap.put("CSIBM284", "CP284"); - fIANA2JavaMap.put("EBCDIC-CP-ES", "CP284"); - fIANA2JavaMap.put("EBCDIC-CP-GB", "CP285"); - fIANA2JavaMap.put("IBM285", "CP285"); - fIANA2JavaMap.put("CP285", "CP285"); - fIANA2JavaMap.put("CSIBM285", "CP285"); - fIANA2JavaMap.put("EBCDIC-JP-KANA", "CP290"); - fIANA2JavaMap.put("IBM290", "CP290"); - fIANA2JavaMap.put("CP290", "CP290"); - fIANA2JavaMap.put("CSIBM290", "CP290"); - fIANA2JavaMap.put("EBCDIC-CP-FR", "CP297"); - fIANA2JavaMap.put("IBM297", "CP297"); - fIANA2JavaMap.put("CP297", "CP297"); - fIANA2JavaMap.put("CSIBM297", "CP297"); - fIANA2JavaMap.put("EBCDIC-CP-AR1", "CP420"); - fIANA2JavaMap.put("IBM420", "CP420"); - fIANA2JavaMap.put("CP420", "CP420"); - fIANA2JavaMap.put("CSIBM420", "CP420"); - fIANA2JavaMap.put("EBCDIC-CP-HE", "CP424"); - fIANA2JavaMap.put("IBM424", "CP424"); - fIANA2JavaMap.put("CP424", "CP424"); - fIANA2JavaMap.put("CSIBM424", "CP424"); - fIANA2JavaMap.put("IBM437", "CP437"); - fIANA2JavaMap.put("437", "CP437"); - fIANA2JavaMap.put("CP437", "CP437"); - fIANA2JavaMap.put("CSPC8CODEPAGE437", "CP437"); - fIANA2JavaMap.put("EBCDIC-CP-CH", "CP500"); - fIANA2JavaMap.put("IBM500", "CP500"); - fIANA2JavaMap.put("CP500", "CP500"); - fIANA2JavaMap.put("CSIBM500", "CP500"); - fIANA2JavaMap.put("EBCDIC-CP-CH", "CP500"); - fIANA2JavaMap.put("EBCDIC-CP-BE", "CP500"); - fIANA2JavaMap.put("IBM775", "CP775"); - fIANA2JavaMap.put("CP775", "CP775"); - fIANA2JavaMap.put("CSPC775BALTIC", "CP775"); - fIANA2JavaMap.put("IBM850", "CP850"); - fIANA2JavaMap.put("850", "CP850"); - fIANA2JavaMap.put("CP850", "CP850"); - fIANA2JavaMap.put("CSPC850MULTILINGUAL", "CP850"); - fIANA2JavaMap.put("IBM852", "CP852"); - fIANA2JavaMap.put("852", "CP852"); - fIANA2JavaMap.put("CP852", "CP852"); - fIANA2JavaMap.put("CSPCP852", "CP852"); - fIANA2JavaMap.put("IBM855", "CP855"); - fIANA2JavaMap.put("855", "CP855"); - fIANA2JavaMap.put("CP855", "CP855"); - fIANA2JavaMap.put("CSIBM855", "CP855"); - fIANA2JavaMap.put("IBM857", "CP857"); - fIANA2JavaMap.put("857", "CP857"); - fIANA2JavaMap.put("CP857", "CP857"); - fIANA2JavaMap.put("CSIBM857", "CP857"); - fIANA2JavaMap.put("IBM00858", "CP858"); - fIANA2JavaMap.put("CP00858", "CP858"); - fIANA2JavaMap.put("CCSID00858", "CP858"); - fIANA2JavaMap.put("IBM860", "CP860"); - fIANA2JavaMap.put("860", "CP860"); - fIANA2JavaMap.put("CP860", "CP860"); - fIANA2JavaMap.put("CSIBM860", "CP860"); - fIANA2JavaMap.put("IBM861", "CP861"); - fIANA2JavaMap.put("861", "CP861"); - fIANA2JavaMap.put("CP861", "CP861"); - fIANA2JavaMap.put("CP-IS", "CP861"); - fIANA2JavaMap.put("CSIBM861", "CP861"); - fIANA2JavaMap.put("IBM862", "CP862"); - fIANA2JavaMap.put("862", "CP862"); - fIANA2JavaMap.put("CP862", "CP862"); - fIANA2JavaMap.put("CSPC862LATINHEBREW", "CP862"); - fIANA2JavaMap.put("IBM863", "CP863"); - fIANA2JavaMap.put("863", "CP863"); - fIANA2JavaMap.put("CP863", "CP863"); - fIANA2JavaMap.put("CSIBM863", "CP863"); - fIANA2JavaMap.put("IBM864", "CP864"); - fIANA2JavaMap.put("CP864", "CP864"); - fIANA2JavaMap.put("CSIBM864", "CP864"); - fIANA2JavaMap.put("IBM865", "CP865"); - fIANA2JavaMap.put("865", "CP865"); - fIANA2JavaMap.put("CP865", "CP865"); - fIANA2JavaMap.put("CSIBM865", "CP865"); - fIANA2JavaMap.put("IBM866", "CP866"); - fIANA2JavaMap.put("866", "CP866"); - fIANA2JavaMap.put("CP866", "CP866"); - fIANA2JavaMap.put("CSIBM866", "CP866"); - fIANA2JavaMap.put("IBM868", "CP868"); - fIANA2JavaMap.put("CP868", "CP868"); - fIANA2JavaMap.put("CSIBM868", "CP868"); - fIANA2JavaMap.put("CP-AR", "CP868"); - fIANA2JavaMap.put("IBM869", "CP869"); - fIANA2JavaMap.put("CP869", "CP869"); - fIANA2JavaMap.put("CSIBM869", "CP869"); - fIANA2JavaMap.put("CP-GR", "CP869"); - fIANA2JavaMap.put("IBM870", "CP870"); - fIANA2JavaMap.put("CP870", "CP870"); - fIANA2JavaMap.put("CSIBM870", "CP870"); - fIANA2JavaMap.put("EBCDIC-CP-ROECE", "CP870"); - fIANA2JavaMap.put("EBCDIC-CP-YU", "CP870"); - fIANA2JavaMap.put("IBM871", "CP871"); - fIANA2JavaMap.put("CP871", "CP871"); - fIANA2JavaMap.put("CSIBM871", "CP871"); - fIANA2JavaMap.put("EBCDIC-CP-IS", "CP871"); - fIANA2JavaMap.put("IBM918", "CP918"); - fIANA2JavaMap.put("CP918", "CP918"); - fIANA2JavaMap.put("CSIBM918", "CP918"); - fIANA2JavaMap.put("EBCDIC-CP-AR2", "CP918"); - fIANA2JavaMap.put("IBM00924", "CP924"); - fIANA2JavaMap.put("CP00924", "CP924"); - fIANA2JavaMap.put("CCSID00924", "CP924"); - // is this an error??? - fIANA2JavaMap.put("EBCDIC-LATIN9--EURO", "CP924"); - fIANA2JavaMap.put("IBM1026", "CP1026"); - fIANA2JavaMap.put("CP1026", "CP1026"); - fIANA2JavaMap.put("CSIBM1026", "CP1026"); - fIANA2JavaMap.put("IBM01140", "Cp1140"); - fIANA2JavaMap.put("CP01140", "Cp1140"); - fIANA2JavaMap.put("CCSID01140", "Cp1140"); - fIANA2JavaMap.put("IBM01141", "Cp1141"); - fIANA2JavaMap.put("CP01141", "Cp1141"); - fIANA2JavaMap.put("CCSID01141", "Cp1141"); - fIANA2JavaMap.put("IBM01142", "Cp1142"); - fIANA2JavaMap.put("CP01142", "Cp1142"); - fIANA2JavaMap.put("CCSID01142", "Cp1142"); - fIANA2JavaMap.put("IBM01143", "Cp1143"); - fIANA2JavaMap.put("CP01143", "Cp1143"); - fIANA2JavaMap.put("CCSID01143", "Cp1143"); - fIANA2JavaMap.put("IBM01144", "Cp1144"); - fIANA2JavaMap.put("CP01144", "Cp1144"); - fIANA2JavaMap.put("CCSID01144", "Cp1144"); - fIANA2JavaMap.put("IBM01145", "Cp1145"); - fIANA2JavaMap.put("CP01145", "Cp1145"); - fIANA2JavaMap.put("CCSID01145", "Cp1145"); - fIANA2JavaMap.put("IBM01146", "Cp1146"); - fIANA2JavaMap.put("CP01146", "Cp1146"); - fIANA2JavaMap.put("CCSID01146", "Cp1146"); - fIANA2JavaMap.put("IBM01147", "Cp1147"); - fIANA2JavaMap.put("CP01147", "Cp1147"); - fIANA2JavaMap.put("CCSID01147", "Cp1147"); - fIANA2JavaMap.put("IBM01148", "Cp1148"); - fIANA2JavaMap.put("CP01148", "Cp1148"); - fIANA2JavaMap.put("CCSID01148", "Cp1148"); - fIANA2JavaMap.put("IBM01149", "Cp1149"); - fIANA2JavaMap.put("CP01149", "Cp1149"); - fIANA2JavaMap.put("CCSID01149", "Cp1149"); - fIANA2JavaMap.put("EUC-JP", "EUCJIS"); - fIANA2JavaMap.put("CSEUCPKDFMTJAPANESE", "EUCJIS"); - fIANA2JavaMap.put("EXTENDED_UNIX_CODE_PACKED_FORMAT_FOR_JAPANESE", "EUCJIS"); - fIANA2JavaMap.put("EUC-KR", "KSC5601"); - fIANA2JavaMap.put("CSEUCKR", "KSC5601"); - fIANA2JavaMap.put("KS_C_5601-1987", "KS_C_5601-1987"); - fIANA2JavaMap.put("ISO-IR-149", "KS_C_5601-1987"); - fIANA2JavaMap.put("KS_C_5601-1989", "KS_C_5601-1987"); - fIANA2JavaMap.put("KSC_5601", "KS_C_5601-1987"); - fIANA2JavaMap.put("KOREAN", "KS_C_5601-1987"); - fIANA2JavaMap.put("CSKSC56011987", "KS_C_5601-1987"); - fIANA2JavaMap.put("GB2312", "GB2312"); - fIANA2JavaMap.put("CSGB2312", "GB2312"); - fIANA2JavaMap.put("ISO-2022-JP", "JIS"); - fIANA2JavaMap.put("CSISO2022JP", "JIS"); - fIANA2JavaMap.put("ISO-2022-KR", "ISO2022KR"); - fIANA2JavaMap.put("CSISO2022KR", "ISO2022KR"); - fIANA2JavaMap.put("ISO-2022-CN", "ISO2022CN"); - - fIANA2JavaMap.put("X0201", "JIS0201"); - fIANA2JavaMap.put("CSISO13JISC6220JP", "JIS0201"); - fIANA2JavaMap.put("X0208", "JIS0208"); - fIANA2JavaMap.put("ISO-IR-87", "JIS0208"); - fIANA2JavaMap.put("X0208dbiJIS_X0208-1983", "JIS0208"); - fIANA2JavaMap.put("CSISO87JISX0208", "JIS0208"); - fIANA2JavaMap.put("X0212", "JIS0212"); - fIANA2JavaMap.put("ISO-IR-159", "JIS0212"); - fIANA2JavaMap.put("CSISO159JISX02121990", "JIS0212"); - fIANA2JavaMap.put("GB18030", "GB18030"); - fIANA2JavaMap.put("GBK", "GBK"); - fIANA2JavaMap.put("CP936", "GBK"); - fIANA2JavaMap.put("MS936", "GBK"); - fIANA2JavaMap.put("WINDOWS-936", "GBK"); - fIANA2JavaMap.put("SHIFT_JIS", "SJIS"); - fIANA2JavaMap.put("CSSHIFTJIS", "SJIS"); - fIANA2JavaMap.put("MS_KANJI", "SJIS"); - fIANA2JavaMap.put("WINDOWS-31J", "MS932"); - fIANA2JavaMap.put("CSWINDOWS31J", "MS932"); - - // Add support for Cp1252 and its friends - fIANA2JavaMap.put("WINDOWS-1250", "Cp1250"); - fIANA2JavaMap.put("WINDOWS-1251", "Cp1251"); - fIANA2JavaMap.put("WINDOWS-1252", "Cp1252"); - fIANA2JavaMap.put("WINDOWS-1253", "Cp1253"); - fIANA2JavaMap.put("WINDOWS-1254", "Cp1254"); - fIANA2JavaMap.put("WINDOWS-1255", "Cp1255"); - fIANA2JavaMap.put("WINDOWS-1256", "Cp1256"); - fIANA2JavaMap.put("WINDOWS-1257", "Cp1257"); - fIANA2JavaMap.put("WINDOWS-1258", "Cp1258"); - fIANA2JavaMap.put("TIS-620", "TIS620"); - - fIANA2JavaMap.put("ISO-8859-1", "ISO8859_1"); - fIANA2JavaMap.put("ISO-IR-100", "ISO8859_1"); - fIANA2JavaMap.put("ISO_8859-1", "ISO8859_1"); - fIANA2JavaMap.put("LATIN1", "ISO8859_1"); - fIANA2JavaMap.put("CSISOLATIN1", "ISO8859_1"); - fIANA2JavaMap.put("L1", "ISO8859_1"); - fIANA2JavaMap.put("IBM819", "ISO8859_1"); - fIANA2JavaMap.put("CP819", "ISO8859_1"); - - fIANA2JavaMap.put("ISO-8859-2", "ISO8859_2"); - fIANA2JavaMap.put("ISO-IR-101", "ISO8859_2"); - fIANA2JavaMap.put("ISO_8859-2", "ISO8859_2"); - fIANA2JavaMap.put("LATIN2", "ISO8859_2"); - fIANA2JavaMap.put("CSISOLATIN2", "ISO8859_2"); - fIANA2JavaMap.put("L2", "ISO8859_2"); - - fIANA2JavaMap.put("ISO-8859-3", "ISO8859_3"); - fIANA2JavaMap.put("ISO-IR-109", "ISO8859_3"); - fIANA2JavaMap.put("ISO_8859-3", "ISO8859_3"); - fIANA2JavaMap.put("LATIN3", "ISO8859_3"); - fIANA2JavaMap.put("CSISOLATIN3", "ISO8859_3"); - fIANA2JavaMap.put("L3", "ISO8859_3"); - - fIANA2JavaMap.put("ISO-8859-4", "ISO8859_4"); - fIANA2JavaMap.put("ISO-IR-110", "ISO8859_4"); - fIANA2JavaMap.put("ISO_8859-4", "ISO8859_4"); - fIANA2JavaMap.put("LATIN4", "ISO8859_4"); - fIANA2JavaMap.put("CSISOLATIN4", "ISO8859_4"); - fIANA2JavaMap.put("L4", "ISO8859_4"); - - fIANA2JavaMap.put("ISO-8859-5", "ISO8859_5"); - fIANA2JavaMap.put("ISO-IR-144", "ISO8859_5"); - fIANA2JavaMap.put("ISO_8859-5", "ISO8859_5"); - fIANA2JavaMap.put("CYRILLIC", "ISO8859_5"); - fIANA2JavaMap.put("CSISOLATINCYRILLIC", "ISO8859_5"); - - fIANA2JavaMap.put("ISO-8859-6", "ISO8859_6"); - fIANA2JavaMap.put("ISO-IR-127", "ISO8859_6"); - fIANA2JavaMap.put("ISO_8859-6", "ISO8859_6"); - fIANA2JavaMap.put("ECMA-114", "ISO8859_6"); - fIANA2JavaMap.put("ASMO-708", "ISO8859_6"); - fIANA2JavaMap.put("ARABIC", "ISO8859_6"); - fIANA2JavaMap.put("CSISOLATINARABIC", "ISO8859_6"); - - fIANA2JavaMap.put("ISO-8859-7", "ISO8859_7"); - fIANA2JavaMap.put("ISO-IR-126", "ISO8859_7"); - fIANA2JavaMap.put("ISO_8859-7", "ISO8859_7"); - fIANA2JavaMap.put("ELOT_928", "ISO8859_7"); - fIANA2JavaMap.put("ECMA-118", "ISO8859_7"); - fIANA2JavaMap.put("GREEK", "ISO8859_7"); - fIANA2JavaMap.put("CSISOLATINGREEK", "ISO8859_7"); - fIANA2JavaMap.put("GREEK8", "ISO8859_7"); - - fIANA2JavaMap.put("ISO-8859-8", "ISO8859_8"); - fIANA2JavaMap.put("ISO-8859-8-I", "ISO8859_8"); // added since this encoding only differs w.r.t. presentation - fIANA2JavaMap.put("ISO-IR-138", "ISO8859_8"); - fIANA2JavaMap.put("ISO_8859-8", "ISO8859_8"); - fIANA2JavaMap.put("HEBREW", "ISO8859_8"); - fIANA2JavaMap.put("CSISOLATINHEBREW", "ISO8859_8"); - - fIANA2JavaMap.put("ISO-8859-9", "ISO8859_9"); - fIANA2JavaMap.put("ISO-IR-148", "ISO8859_9"); - fIANA2JavaMap.put("ISO_8859-9", "ISO8859_9"); - fIANA2JavaMap.put("LATIN5", "ISO8859_9"); - fIANA2JavaMap.put("CSISOLATIN5", "ISO8859_9"); - fIANA2JavaMap.put("L5", "ISO8859_9"); - - fIANA2JavaMap.put("ISO-8859-13", "ISO8859_13"); - - fIANA2JavaMap.put("ISO-8859-15", "ISO8859_15_FDIS"); - fIANA2JavaMap.put("ISO_8859-15", "ISO8859_15_FDIS"); - fIANA2JavaMap.put("LATIN-9", "ISO8859_15_FDIS"); - - fIANA2JavaMap.put("KOI8-R", "KOI8_R"); - fIANA2JavaMap.put("CSKOI8R", "KOI8_R"); - fIANA2JavaMap.put("US-ASCII", "ASCII"); - fIANA2JavaMap.put("ISO-IR-6", "ASCII"); - fIANA2JavaMap.put("ANSI_X3.4-1968", "ASCII"); - fIANA2JavaMap.put("ANSI_X3.4-1986", "ASCII"); - fIANA2JavaMap.put("ISO_646.IRV:1991", "ASCII"); - fIANA2JavaMap.put("ASCII", "ASCII"); - fIANA2JavaMap.put("CSASCII", "ASCII"); - fIANA2JavaMap.put("ISO646-US", "ASCII"); - fIANA2JavaMap.put("US", "ASCII"); - fIANA2JavaMap.put("IBM367", "ASCII"); - fIANA2JavaMap.put("CP367", "ASCII"); - fIANA2JavaMap.put("UTF-8", "UTF8"); - fIANA2JavaMap.put("UTF-16", "UTF-16"); - fIANA2JavaMap.put("UTF-16BE", "UnicodeBig"); - fIANA2JavaMap.put("UTF-16LE", "UnicodeLittle"); - - // support for 1047, as proposed to be added to the - // IANA registry in - // http://lists.w3.org/Archives/Public/ietf-charset/2002JulSep/0049.html - fIANA2JavaMap.put("IBM-1047", "Cp1047"); - fIANA2JavaMap.put("IBM1047", "Cp1047"); - fIANA2JavaMap.put("CP1047", "Cp1047"); - - // Adding new aliases as proposed in - // http://lists.w3.org/Archives/Public/ietf-charset/2002JulSep/0058.html - fIANA2JavaMap.put("IBM-37", "CP037"); - fIANA2JavaMap.put("IBM-273", "CP273"); - fIANA2JavaMap.put("IBM-277", "CP277"); - fIANA2JavaMap.put("IBM-278", "CP278"); - fIANA2JavaMap.put("IBM-280", "CP280"); - fIANA2JavaMap.put("IBM-284", "CP284"); - fIANA2JavaMap.put("IBM-285", "CP285"); - fIANA2JavaMap.put("IBM-290", "CP290"); - fIANA2JavaMap.put("IBM-297", "CP297"); - fIANA2JavaMap.put("IBM-420", "CP420"); - fIANA2JavaMap.put("IBM-424", "CP424"); - fIANA2JavaMap.put("IBM-437", "CP437"); - fIANA2JavaMap.put("IBM-500", "CP500"); - fIANA2JavaMap.put("IBM-775", "CP775"); - fIANA2JavaMap.put("IBM-850", "CP850"); - fIANA2JavaMap.put("IBM-852", "CP852"); - fIANA2JavaMap.put("IBM-855", "CP855"); - fIANA2JavaMap.put("IBM-857", "CP857"); - fIANA2JavaMap.put("IBM-858", "CP858"); - fIANA2JavaMap.put("IBM-860", "CP860"); - fIANA2JavaMap.put("IBM-861", "CP861"); - fIANA2JavaMap.put("IBM-862", "CP862"); - fIANA2JavaMap.put("IBM-863", "CP863"); - fIANA2JavaMap.put("IBM-864", "CP864"); - fIANA2JavaMap.put("IBM-865", "CP865"); - fIANA2JavaMap.put("IBM-866", "CP866"); - fIANA2JavaMap.put("IBM-868", "CP868"); - fIANA2JavaMap.put("IBM-869", "CP869"); - fIANA2JavaMap.put("IBM-870", "CP870"); - fIANA2JavaMap.put("IBM-871", "CP871"); - fIANA2JavaMap.put("IBM-918", "CP918"); - fIANA2JavaMap.put("IBM-924", "CP924"); - fIANA2JavaMap.put("IBM-1026", "CP1026"); - fIANA2JavaMap.put("IBM-1140", "Cp1140"); - fIANA2JavaMap.put("IBM-1141", "Cp1141"); - fIANA2JavaMap.put("IBM-1142", "Cp1142"); - fIANA2JavaMap.put("IBM-1143", "Cp1143"); - fIANA2JavaMap.put("IBM-1144", "Cp1144"); - fIANA2JavaMap.put("IBM-1145", "Cp1145"); - fIANA2JavaMap.put("IBM-1146", "Cp1146"); - fIANA2JavaMap.put("IBM-1147", "Cp1147"); - fIANA2JavaMap.put("IBM-1148", "Cp1148"); - fIANA2JavaMap.put("IBM-1149", "Cp1149"); - fIANA2JavaMap.put("IBM-819", "ISO8859_1"); - fIANA2JavaMap.put("IBM-367", "ASCII"); - - // REVISIT: - // j:CNS11643 -> EUC-TW? - // ISO-2022-CN? ISO-2022-CN-EXT? - - // add Java to IANA encoding mappings - //fJava2IANAMap.put("8859_1", "US-ASCII"); // ? - fJava2IANAMap.put("ISO8859_1", "ISO-8859-1"); - fJava2IANAMap.put("ISO8859_2", "ISO-8859-2"); - fJava2IANAMap.put("ISO8859_3", "ISO-8859-3"); - fJava2IANAMap.put("ISO8859_4", "ISO-8859-4"); - fJava2IANAMap.put("ISO8859_5", "ISO-8859-5"); - fJava2IANAMap.put("ISO8859_6", "ISO-8859-6"); - fJava2IANAMap.put("ISO8859_7", "ISO-8859-7"); - fJava2IANAMap.put("ISO8859_8", "ISO-8859-8"); - fJava2IANAMap.put("ISO8859_9", "ISO-8859-9"); - fJava2IANAMap.put("ISO8859_13", "ISO-8859-13"); - fJava2IANAMap.put("ISO8859_15", "ISO-8859-15"); - fJava2IANAMap.put("ISO8859_15_FDIS", "ISO-8859-15"); - fJava2IANAMap.put("Big5", "BIG5"); - fJava2IANAMap.put("CP037", "EBCDIC-CP-US"); - fJava2IANAMap.put("CP273", "IBM273"); - fJava2IANAMap.put("CP277", "EBCDIC-CP-DK"); - fJava2IANAMap.put("CP278", "EBCDIC-CP-FI"); - fJava2IANAMap.put("CP280", "EBCDIC-CP-IT"); - fJava2IANAMap.put("CP284", "EBCDIC-CP-ES"); - fJava2IANAMap.put("CP285", "EBCDIC-CP-GB"); - fJava2IANAMap.put("CP290", "EBCDIC-JP-KANA"); - fJava2IANAMap.put("CP297", "EBCDIC-CP-FR"); - fJava2IANAMap.put("CP420", "EBCDIC-CP-AR1"); - fJava2IANAMap.put("CP424", "EBCDIC-CP-HE"); - fJava2IANAMap.put("CP437", "IBM437"); - fJava2IANAMap.put("CP500", "EBCDIC-CP-CH"); - fJava2IANAMap.put("CP775", "IBM775"); - fJava2IANAMap.put("CP850", "IBM850"); - fJava2IANAMap.put("CP852", "IBM852"); - fJava2IANAMap.put("CP855", "IBM855"); - fJava2IANAMap.put("CP857", "IBM857"); - fJava2IANAMap.put("CP858", "IBM00858"); - fJava2IANAMap.put("CP860", "IBM860"); - fJava2IANAMap.put("CP861", "IBM861"); - fJava2IANAMap.put("CP862", "IBM862"); - fJava2IANAMap.put("CP863", "IBM863"); - fJava2IANAMap.put("CP864", "IBM864"); - fJava2IANAMap.put("CP865", "IBM865"); - fJava2IANAMap.put("CP866", "IBM866"); - fJava2IANAMap.put("CP868", "IBM868"); - fJava2IANAMap.put("CP869", "IBM869"); - fJava2IANAMap.put("CP870", "EBCDIC-CP-ROECE"); - fJava2IANAMap.put("CP871", "EBCDIC-CP-IS"); - fJava2IANAMap.put("CP918", "EBCDIC-CP-AR2"); - fJava2IANAMap.put("CP924", "IBM00924"); - fJava2IANAMap.put("CP1026", "IBM1026"); - fJava2IANAMap.put("Cp01140", "IBM01140"); - fJava2IANAMap.put("Cp01141", "IBM01141"); - fJava2IANAMap.put("Cp01142", "IBM01142"); - fJava2IANAMap.put("Cp01143", "IBM01143"); - fJava2IANAMap.put("Cp01144", "IBM01144"); - fJava2IANAMap.put("Cp01145", "IBM01145"); - fJava2IANAMap.put("Cp01146", "IBM01146"); - fJava2IANAMap.put("Cp01147", "IBM01147"); - fJava2IANAMap.put("Cp01148", "IBM01148"); - fJava2IANAMap.put("Cp01149", "IBM01149"); - fJava2IANAMap.put("EUCJIS", "EUC-JP"); - fJava2IANAMap.put("KS_C_5601-1987", "KS_C_5601-1987"); - fJava2IANAMap.put("GB2312", "GB2312"); - fJava2IANAMap.put("ISO2022KR", "ISO-2022-KR"); - fJava2IANAMap.put("ISO2022CN", "ISO-2022-CN"); - fJava2IANAMap.put("JIS", "ISO-2022-JP"); - fJava2IANAMap.put("KOI8_R", "KOI8-R"); - fJava2IANAMap.put("KSC5601", "EUC-KR"); - fJava2IANAMap.put("GB18030", "GB18030"); - fJava2IANAMap.put("GBK", "GBK"); - fJava2IANAMap.put("SJIS", "SHIFT_JIS"); - fJava2IANAMap.put("MS932", "WINDOWS-31J"); - fJava2IANAMap.put("UTF8", "UTF-8"); - fJava2IANAMap.put("Unicode", "UTF-16"); - fJava2IANAMap.put("UnicodeBig", "UTF-16BE"); - fJava2IANAMap.put("UnicodeLittle", "UTF-16LE"); - fJava2IANAMap.put("JIS0201", "X0201"); - fJava2IANAMap.put("JIS0208", "X0208"); - fJava2IANAMap.put("JIS0212", "ISO-IR-159"); - - // proposed addition (see above for details): - fJava2IANAMap.put("CP1047", "IBM1047"); - - } // () - - // - // Constructors - // - - /** Default constructor. */ - public EncodingMap() {} - - // - // Public static methods - // - - /** - * Adds an IANA to Java encoding name mapping. - * - * @param ianaEncoding The IANA encoding name. - * @param javaEncoding The Java encoding name. - */ - public static void putIANA2JavaMapping(String ianaEncoding, - String javaEncoding) { - fIANA2JavaMap.put(ianaEncoding, javaEncoding); - } // putIANA2JavaMapping(String,String) - - /** - * Returns the Java encoding name for the specified IANA encoding name. - * - * @param ianaEncoding The IANA encoding name. - */ - public static String getIANA2JavaMapping(String ianaEncoding) { - return (String)fIANA2JavaMap.get(ianaEncoding); - } // getIANA2JavaMapping(String):String - - /** - * Removes an IANA to Java encoding name mapping. - * - * @param ianaEncoding The IANA encoding name. - */ - public static String removeIANA2JavaMapping(String ianaEncoding) { - return (String)fIANA2JavaMap.remove(ianaEncoding); - } // removeIANA2JavaMapping(String):String - - /** - * Adds a Java to IANA encoding name mapping. - * - * @param javaEncoding The Java encoding name. - * @param ianaEncoding The IANA encoding name. - */ - public static void putJava2IANAMapping(String javaEncoding, - String ianaEncoding) { - fJava2IANAMap.put(javaEncoding, ianaEncoding); - } // putJava2IANAMapping(String,String) - - /** - * Returns the IANA encoding name for the specified Java encoding name. - * - * @param javaEncoding The Java encoding name. - */ - public static String getJava2IANAMapping(String javaEncoding) { - return (String)fJava2IANAMap.get(javaEncoding); - } // getJava2IANAMapping(String):String - - /** - * Removes a Java to IANA encoding name mapping. - * - * @param javaEncoding The Java encoding name. - */ - public static String removeJava2IANAMapping(String javaEncoding) { - return (String)fJava2IANAMap.remove(javaEncoding); - } // removeJava2IANAMapping - -} // class EncodingMap diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/ParserUtils.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/ParserUtils.java deleted file mode 100644 index 8b32a8708..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/ParserUtils.java +++ /dev/null @@ -1,235 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.xmlparser; - -import java.io.IOException; -import java.io.InputStream; - -import javax.xml.parsers.DocumentBuilder; -import javax.xml.parsers.DocumentBuilderFactory; -import javax.xml.parsers.ParserConfigurationException; - -import org.apache.jasper.Constants; -import org.apache.jasper.JasperException; -import org.apache.jasper.compiler.Localizer; -import org.apache.juli.logging.Log; -import org.apache.juli.logging.LogFactory; -import org.w3c.dom.Comment; -import org.w3c.dom.Document; -import org.w3c.dom.NamedNodeMap; -import org.w3c.dom.Node; -import org.w3c.dom.NodeList; -import org.w3c.dom.Text; -import org.xml.sax.EntityResolver; -import org.xml.sax.ErrorHandler; -import org.xml.sax.InputSource; -import org.xml.sax.SAXException; -import org.xml.sax.SAXParseException; - - -/** - * XML parsing utilities for processing web application deployment - * descriptor and tag library descriptor files. FIXME - make these - * use a separate class loader for the parser to be used. - * - * @author Craig R. McClanahan - * @version $Revision: 595799 $ $Date: 2007-11-16 21:02:12 +0100 (Fri, 16 Nov 2007) $ - */ - -public class ParserUtils { - - /** - * An error handler for use when parsing XML documents. - */ - static ErrorHandler errorHandler = new MyErrorHandler(); - - /** - * An entity resolver for use when parsing XML documents. - */ - static EntityResolver entityResolver = new MyEntityResolver(); - - // Turn off for JSP 2.0 until switch over to using xschema. - public static boolean validating = false; - - - // --------------------------------------------------------- Public Methods - - /** - * Parse the specified XML document, and return a TreeNode - * that corresponds to the root node of the document tree. - * - * @param uri URI of the XML document being parsed - * @param is Input source containing the deployment descriptor - * - * @exception JasperException if an input/output error occurs - * @exception JasperException if a parsing error occurs - */ - public TreeNode parseXMLDocument(String uri, InputSource is) - throws JasperException { - - Document document = null; - - // Perform an XML parse of this document, via JAXP - try { - DocumentBuilderFactory factory = - DocumentBuilderFactory.newInstance(); - factory.setNamespaceAware(true); - factory.setValidating(validating); - DocumentBuilder builder = factory.newDocumentBuilder(); - builder.setEntityResolver(entityResolver); - builder.setErrorHandler(errorHandler); - document = builder.parse(is); - } catch (ParserConfigurationException ex) { - throw new JasperException - (Localizer.getMessage("jsp.error.parse.xml", uri), ex); - } catch (SAXParseException ex) { - throw new JasperException - (Localizer.getMessage("jsp.error.parse.xml.line", - uri, - Integer.toString(ex.getLineNumber()), - Integer.toString(ex.getColumnNumber())), - ex); - } catch (SAXException sx) { - throw new JasperException - (Localizer.getMessage("jsp.error.parse.xml", uri), sx); - } catch (IOException io) { - throw new JasperException - (Localizer.getMessage("jsp.error.parse.xml", uri), io); - } - - // Convert the resulting document to a graph of TreeNodes - return (convert(null, document.getDocumentElement())); - } - - - /** - * Parse the specified XML document, and return a TreeNode - * that corresponds to the root node of the document tree. - * - * @param uri URI of the XML document being parsed - * @param is Input stream containing the deployment descriptor - * - * @exception JasperException if an input/output error occurs - * @exception JasperException if a parsing error occurs - */ - public TreeNode parseXMLDocument(String uri, InputStream is) - throws JasperException { - - return (parseXMLDocument(uri, new InputSource(is))); - } - - - // ------------------------------------------------------ Protected Methods - - - /** - * Create and return a TreeNode that corresponds to the specified Node, - * including processing all of the attributes and children nodes. - * - * @param parent The parent TreeNode (if any) for the new TreeNode - * @param node The XML document Node to be converted - */ - protected TreeNode convert(TreeNode parent, Node node) { - - // Construct a new TreeNode for this node - TreeNode treeNode = new TreeNode(node.getNodeName(), parent); - - // Convert all attributes of this node - NamedNodeMap attributes = node.getAttributes(); - if (attributes != null) { - int n = attributes.getLength(); - for (int i = 0; i < n; i++) { - Node attribute = attributes.item(i); - treeNode.addAttribute(attribute.getNodeName(), - attribute.getNodeValue()); - } - } - - // Create and attach all children of this node - NodeList children = node.getChildNodes(); - if (children != null) { - int n = children.getLength(); - for (int i = 0; i < n; i++) { - Node child = children.item(i); - if (child instanceof Comment) - continue; - if (child instanceof Text) { - String body = ((Text) child).getData(); - if (body != null) { - body = body.trim(); - if (body.length() > 0) - treeNode.setBody(body); - } - } else { - TreeNode treeChild = convert(treeNode, child); - } - } - } - - // Return the completed TreeNode graph - return (treeNode); - } -} - - -// ------------------------------------------------------------ Private Classes - -class MyEntityResolver implements EntityResolver { - - public InputSource resolveEntity(String publicId, String systemId) - throws SAXException { - for (int i = 0; i < Constants.CACHED_DTD_PUBLIC_IDS.length; i++) { - String cachedDtdPublicId = Constants.CACHED_DTD_PUBLIC_IDS[i]; - if (cachedDtdPublicId.equals(publicId)) { - String resourcePath = Constants.CACHED_DTD_RESOURCE_PATHS[i]; - InputStream input = this.getClass().getResourceAsStream( - resourcePath); - if (input == null) { - throw new SAXException(Localizer.getMessage( - "jsp.error.internal.filenotfound", resourcePath)); - } - InputSource isrc = new InputSource(input); - return isrc; - } - } - Log log = LogFactory.getLog(MyEntityResolver.class); - if (log.isDebugEnabled()) - log.debug("Resolve entity failed" + publicId + " " + systemId); - log.error(Localizer.getMessage("jsp.error.parse.xml.invalidPublicId", - publicId)); - return null; - } -} - -class MyErrorHandler implements ErrorHandler { - - public void warning(SAXParseException ex) throws SAXException { - Log log = LogFactory.getLog(MyErrorHandler.class); - if (log.isDebugEnabled()) - log.debug("ParserUtils: warning ", ex); - // We ignore warnings - } - - public void error(SAXParseException ex) throws SAXException { - throw ex; - } - - public void fatalError(SAXParseException ex) throws SAXException { - throw ex; - } -} \ No newline at end of file diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/SymbolTable.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/SymbolTable.java deleted file mode 100644 index f849df358..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/SymbolTable.java +++ /dev/null @@ -1,302 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - * ==================================================================== - * - * This software consists of voluntary contributions made by many - * individuals on behalf of the Apache Software Foundation and was - * originally based on software copyright (c) 1999, International - * Business Machines, Inc., http://www.apache.org. For more - * information on the Apache Software Foundation, please see - * . - */ - -package org.apache.jasper.xmlparser; - -/** - * This class is a symbol table implementation that guarantees that - * strings used as identifiers are unique references. Multiple calls - * to addSymbol will always return the same string - * reference. - *

- * The symbol table performs the same task as String.intern() - * with the following differences: - *

    - *
  • - * A new string object does not need to be created in order to - * retrieve a unique reference. Symbols can be added by using - * a series of characters in a character array. - *
    • - *
  • - * Users of the symbol table can provide their own symbol hashing - * implementation. For example, a simple string hashing algorithm - * may fail to produce a balanced set of hashcodes for symbols - * that are mostly unique. Strings with similar leading - * characters are especially prone to this poor hashing behavior. - *
    • - *
- * - * @author Andy Clark - * @version $Id: SymbolTable.java 467222 2006-10-24 03:17:11Z markt $ - */ -public class SymbolTable { - - // - // Constants - // - - /** Default table size. */ - protected static final int TABLE_SIZE = 101; - - // - // Data - // - - /** Buckets. */ - protected Entry[] fBuckets = null; - - // actual table size - protected int fTableSize; - - // - // Constructors - // - - /** Constructs a symbol table with a default number of buckets. */ - public SymbolTable() { - this(TABLE_SIZE); - } - - /** Constructs a symbol table with a specified number of buckets. */ - public SymbolTable(int tableSize) { - fTableSize = tableSize; - fBuckets = new Entry[fTableSize]; - } - - // - // Public methods - // - - /** - * Adds the specified symbol to the symbol table and returns a - * reference to the unique symbol. If the symbol already exists, - * the previous symbol reference is returned instead, in order - * guarantee that symbol references remain unique. - * - * @param symbol The new symbol. - */ - public String addSymbol(String symbol) { - - // search for identical symbol - int bucket = hash(symbol) % fTableSize; - int length = symbol.length(); - OUTER: for (Entry entry = fBuckets[bucket]; entry != null; entry = entry.next) { - if (length == entry.characters.length) { - for (int i = 0; i < length; i++) { - if (symbol.charAt(i) != entry.characters[i]) { - continue OUTER; - } - } - return entry.symbol; - } - } - - // create new entry - Entry entry = new Entry(symbol, fBuckets[bucket]); - fBuckets[bucket] = entry; - return entry.symbol; - - } // addSymbol(String):String - - /** - * Adds the specified symbol to the symbol table and returns a - * reference to the unique symbol. If the symbol already exists, - * the previous symbol reference is returned instead, in order - * guarantee that symbol references remain unique. - * - * @param buffer The buffer containing the new symbol. - * @param offset The offset into the buffer of the new symbol. - * @param length The length of the new symbol in the buffer. - */ - public String addSymbol(char[] buffer, int offset, int length) { - - // search for identical symbol - int bucket = hash(buffer, offset, length) % fTableSize; - OUTER: for (Entry entry = fBuckets[bucket]; entry != null; entry = entry.next) { - if (length == entry.characters.length) { - for (int i = 0; i < length; i++) { - if (buffer[offset + i] != entry.characters[i]) { - continue OUTER; - } - } - return entry.symbol; - } - } - - // add new entry - Entry entry = new Entry(buffer, offset, length, fBuckets[bucket]); - fBuckets[bucket] = entry; - return entry.symbol; - - } // addSymbol(char[],int,int):String - - /** - * Returns a hashcode value for the specified symbol. The value - * returned by this method must be identical to the value returned - * by the hash(char[],int,int) method when called - * with the character array that comprises the symbol string. - * - * @param symbol The symbol to hash. - */ - public int hash(String symbol) { - - int code = 0; - int length = symbol.length(); - for (int i = 0; i < length; i++) { - code = code * 37 + symbol.charAt(i); - } - return code & 0x7FFFFFF; - - } // hash(String):int - - /** - * Returns a hashcode value for the specified symbol information. - * The value returned by this method must be identical to the value - * returned by the hash(String) method when called - * with the string object created from the symbol information. - * - * @param buffer The character buffer containing the symbol. - * @param offset The offset into the character buffer of the start - * of the symbol. - * @param length The length of the symbol. - */ - public int hash(char[] buffer, int offset, int length) { - - int code = 0; - for (int i = 0; i < length; i++) { - code = code * 37 + buffer[offset + i]; - } - return code & 0x7FFFFFF; - - } // hash(char[],int,int):int - - /** - * Returns true if the symbol table already contains the specified - * symbol. - * - * @param symbol The symbol to look for. - */ - public boolean containsSymbol(String symbol) { - - // search for identical symbol - int bucket = hash(symbol) % fTableSize; - int length = symbol.length(); - OUTER: for (Entry entry = fBuckets[bucket]; entry != null; entry = entry.next) { - if (length == entry.characters.length) { - for (int i = 0; i < length; i++) { - if (symbol.charAt(i) != entry.characters[i]) { - continue OUTER; - } - } - return true; - } - } - - return false; - - } // containsSymbol(String):boolean - - /** - * Returns true if the symbol table already contains the specified - * symbol. - * - * @param buffer The buffer containing the symbol to look for. - * @param offset The offset into the buffer. - * @param length The length of the symbol in the buffer. - */ - public boolean containsSymbol(char[] buffer, int offset, int length) { - - // search for identical symbol - int bucket = hash(buffer, offset, length) % fTableSize; - OUTER: for (Entry entry = fBuckets[bucket]; entry != null; entry = entry.next) { - if (length == entry.characters.length) { - for (int i = 0; i < length; i++) { - if (buffer[offset + i] != entry.characters[i]) { - continue OUTER; - } - } - return true; - } - } - - return false; - - } // containsSymbol(char[],int,int):boolean - - // - // Classes - // - - /** - * This class is a symbol table entry. Each entry acts as a node - * in a linked list. - */ - protected static final class Entry { - - // - // Data - // - - /** Symbol. */ - public String symbol; - - /** - * Symbol characters. This information is duplicated here for - * comparison performance. - */ - public char[] characters; - - /** The next entry. */ - public Entry next; - - // - // Constructors - // - - /** - * Constructs a new entry from the specified symbol and next entry - * reference. - */ - public Entry(String symbol, Entry next) { - this.symbol = symbol.intern(); - characters = new char[symbol.length()]; - symbol.getChars(0, characters.length, characters, 0); - this.next = next; - } - - /** - * Constructs a new entry from the specified symbol information and - * next entry reference. - */ - public Entry(char[] ch, int offset, int length, Entry next) { - characters = new char[length]; - System.arraycopy(ch, offset, characters, 0, length); - symbol = new String(characters).intern(); - this.next = next; - } - - } // class Entry - -} // class SymbolTable diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/TreeNode.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/TreeNode.java deleted file mode 100644 index cfaa3b36f..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/TreeNode.java +++ /dev/null @@ -1,360 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.xmlparser; - -import java.util.ArrayList; -import java.util.Collections; -import java.util.HashMap; -import java.util.Iterator; - - -/** - * Simplified implementation of a Node from a Document Object Model (DOM) - * parse of an XML document. This class is used to represent a DOM tree - * so that the XML parser's implementation of org.w3c.dom need - * not be visible to the remainder of Jasper. - *

- * WARNING - Construction of a new tree, or modifications - * to an existing one, are not thread-safe and such accesses must be - * synchronized. - * - * @author Craig R. McClanahan - * @version $Revision: 467222 $ $Date: 2006-10-24 05:17:11 +0200 (Tue, 24 Oct 2006) $ - */ - -public class TreeNode { - - - // ----------------------------------------------------------- Constructors - - - /** - * Construct a new node with no parent. - * - * @param name The name of this node - */ - public TreeNode(String name) { - - this(name, null); - - } - - - /** - * Construct a new node with the specified parent. - * - * @param name The name of this node - * @param parent The node that is the parent of this node - */ - public TreeNode(String name, TreeNode parent) { - - super(); - this.name = name; - this.parent = parent; - if (this.parent != null) - this.parent.addChild(this); - - } - - - // ----------------------------------------------------- Instance Variables - - - /** - * The attributes of this node, keyed by attribute name, - * Instantiated only if required. - */ - protected HashMap attributes = null; - - - /** - * The body text associated with this node (if any). - */ - protected String body = null; - - - /** - * The children of this node, instantiated only if required. - */ - protected ArrayList children = null; - - - /** - * The name of this node. - */ - protected String name = null; - - - /** - * The parent node of this node. - */ - protected TreeNode parent = null; - - - // --------------------------------------------------------- Public Methods - - - /** - * Add an attribute to this node, replacing any existing attribute - * with the same name. - * - * @param name The attribute name to add - * @param value The new attribute value - */ - public void addAttribute(String name, String value) { - - if (attributes == null) - attributes = new HashMap(); - attributes.put(name, value); - - } - - - /** - * Add a new child node to this node. - * - * @param node The new child node - */ - public void addChild(TreeNode node) { - - if (children == null) - children = new ArrayList(); - children.add(node); - - } - - - /** - * Return the value of the specified node attribute if it exists, or - * null otherwise. - * - * @param name Name of the requested attribute - */ - public String findAttribute(String name) { - - if (attributes == null) - return (null); - else - return ((String) attributes.get(name)); - - } - - - /** - * Return an Iterator of the attribute names of this node. If there are - * no attributes, an empty Iterator is returned. - */ - public Iterator findAttributes() { - - if (attributes == null) - return (Collections.EMPTY_LIST.iterator()); - else - return (attributes.keySet().iterator()); - - } - - - /** - * Return the first child node of this node with the specified name, - * if there is one; otherwise, return null. - * - * @param name Name of the desired child element - */ - public TreeNode findChild(String name) { - - if (children == null) - return (null); - Iterator items = children.iterator(); - while (items.hasNext()) { - TreeNode item = (TreeNode) items.next(); - if (name.equals(item.getName())) - return (item); - } - return (null); - - } - - - /** - * Return an Iterator of all children of this node. If there are no - * children, an empty Iterator is returned. - */ - public Iterator findChildren() { - - if (children == null) - return (Collections.EMPTY_LIST.iterator()); - else - return (children.iterator()); - - } - - - /** - * Return an Iterator over all children of this node that have the - * specified name. If there are no such children, an empty Iterator - * is returned. - * - * @param name Name used to select children - */ - public Iterator findChildren(String name) { - - if (children == null) - return (Collections.EMPTY_LIST.iterator()); - - ArrayList results = new ArrayList(); - Iterator items = children.iterator(); - while (items.hasNext()) { - TreeNode item = (TreeNode) items.next(); - if (name.equals(item.getName())) - results.add(item); - } - return (results.iterator()); - - } - - - /** - * Return the body text associated with this node (if any). - */ - public String getBody() { - - return (this.body); - - } - - - /** - * Return the name of this node. - */ - public String getName() { - - return (this.name); - - } - - - /** - * Remove any existing value for the specified attribute name. - * - * @param name The attribute name to remove - */ - public void removeAttribute(String name) { - - if (attributes != null) - attributes.remove(name); - - } - - - /** - * Remove a child node from this node, if it is one. - * - * @param node The child node to remove - */ - public void removeNode(TreeNode node) { - - if (children != null) - children.remove(node); - - } - - - /** - * Set the body text associated with this node (if any). - * - * @param body The body text (if any) - */ - public void setBody(String body) { - - this.body = body; - - } - - - /** - * Return a String representation of this TreeNode. - */ - public String toString() { - - StringBuffer sb = new StringBuffer(); - toString(sb, 0, this); - return (sb.toString()); - - } - - - // ------------------------------------------------------ Protected Methods - - - /** - * Append to the specified StringBuffer a character representation of - * this node, with the specified amount of indentation. - * - * @param sb The StringBuffer to append to - * @param indent Number of characters of indentation - * @param node The TreeNode to be printed - */ - protected void toString(StringBuffer sb, int indent, - TreeNode node) { - - int indent2 = indent + 2; - - // Reconstruct an opening node - for (int i = 0; i < indent; i++) - sb.append(' '); - sb.append('<'); - sb.append(node.getName()); - Iterator names = node.findAttributes(); - while (names.hasNext()) { - sb.append(' '); - String name = (String) names.next(); - sb.append(name); - sb.append("=\""); - String value = node.findAttribute(name); - sb.append(value); - sb.append("\""); - } - sb.append(">\n"); - - // Reconstruct the body text of this node (if any) - String body = node.getBody(); - if ((body != null) && (body.length() > 0)) { - for (int i = 0; i < indent2; i++) - sb.append(' '); - sb.append(body); - sb.append("\n"); - } - - // Reconstruct child nodes with extra indentation - Iterator children = node.findChildren(); - while (children.hasNext()) { - TreeNode child = (TreeNode) children.next(); - toString(sb, indent2, child); - } - - // Reconstruct a closing node marker - for (int i = 0; i < indent; i++) - sb.append(' '); - sb.append("\n"); - - } - - -} diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/UCSReader.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/UCSReader.java deleted file mode 100644 index 90498001a..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/UCSReader.java +++ /dev/null @@ -1,301 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.xmlparser; - -import java.io.InputStream; -import java.io.IOException; -import java.io.Reader; - -/** - * Reader for UCS-2 and UCS-4 encodings. - * (i.e., encodings from ISO-10646-UCS-(2|4)). - * - * @author Neil Graham, IBM - * - * @version $Id: UCSReader.java 467222 2006-10-24 03:17:11Z markt $ - */ -public class UCSReader extends Reader { - - private org.apache.juli.logging.Log log= - org.apache.juli.logging.LogFactory.getLog( UCSReader.class ); - - // - // Constants - // - - /** Default byte buffer size (8192, larger than that of ASCIIReader - * since it's reasonable to surmise that the average UCS-4-encoded - * file should be 4 times as large as the average ASCII-encoded file). - */ - public static final int DEFAULT_BUFFER_SIZE = 8192; - - public static final short UCS2LE = 1; - public static final short UCS2BE = 2; - public static final short UCS4LE = 4; - public static final short UCS4BE = 8; - - // - // Data - // - - /** Input stream. */ - protected InputStream fInputStream; - - /** Byte buffer. */ - protected byte[] fBuffer; - - // what kind of data we're dealing with - protected short fEncoding; - - // - // Constructors - // - - /** - * Constructs an ASCII reader from the specified input stream - * using the default buffer size. The Endian-ness and whether this is - * UCS-2 or UCS-4 needs also to be known in advance. - * - * @param inputStream The input stream. - * @param encoding One of UCS2LE, UCS2BE, UCS4LE or UCS4BE. - */ - public UCSReader(InputStream inputStream, short encoding) { - this(inputStream, DEFAULT_BUFFER_SIZE, encoding); - } // (InputStream, short) - - /** - * Constructs an ASCII reader from the specified input stream - * and buffer size. The Endian-ness and whether this is - * UCS-2 or UCS-4 needs also to be known in advance. - * - * @param inputStream The input stream. - * @param size The initial buffer size. - * @param encoding One of UCS2LE, UCS2BE, UCS4LE or UCS4BE. - */ - public UCSReader(InputStream inputStream, int size, short encoding) { - fInputStream = inputStream; - fBuffer = new byte[size]; - fEncoding = encoding; - } // (InputStream,int,short) - - // - // Reader methods - // - - /** - * Read a single character. This method will block until a character is - * available, an I/O error occurs, or the end of the stream is reached. - * - *

Subclasses that intend to support efficient single-character input - * should override this method. - * - * @return The character read, as an integer in the range 0 to 127 - * (0x00-0x7f), or -1 if the end of the stream has - * been reached - * - * @exception IOException If an I/O error occurs - */ - public int read() throws IOException { - int b0 = fInputStream.read() & 0xff; - if (b0 == 0xff) - return -1; - int b1 = fInputStream.read() & 0xff; - if (b1 == 0xff) - return -1; - if(fEncoding >=4) { - int b2 = fInputStream.read() & 0xff; - if (b2 == 0xff) - return -1; - int b3 = fInputStream.read() & 0xff; - if (b3 == 0xff) - return -1; - if (log.isDebugEnabled()) - log.debug("b0 is " + (b0 & 0xff) + " b1 " + (b1 & 0xff) + " b2 " + (b2 & 0xff) + " b3 " + (b3 & 0xff)); - if (fEncoding == UCS4BE) - return (b0<<24)+(b1<<16)+(b2<<8)+b3; - else - return (b3<<24)+(b2<<16)+(b1<<8)+b0; - } else { // UCS-2 - if (fEncoding == UCS2BE) - return (b0<<8)+b1; - else - return (b1<<8)+b0; - } - } // read():int - - /** - * Read characters into a portion of an array. This method will block - * until some input is available, an I/O error occurs, or the end of the - * stream is reached. - * - * @param ch Destination buffer - * @param offset Offset at which to start storing characters - * @param length Maximum number of characters to read - * - * @return The number of characters read, or -1 if the end of the - * stream has been reached - * - * @exception IOException If an I/O error occurs - */ - public int read(char ch[], int offset, int length) throws IOException { - int byteLength = length << ((fEncoding >= 4)?2:1); - if (byteLength > fBuffer.length) { - byteLength = fBuffer.length; - } - int count = fInputStream.read(fBuffer, 0, byteLength); - if(count == -1) return -1; - // try and make count be a multiple of the number of bytes we're looking for - if(fEncoding >= 4) { // BigEndian - // this looks ugly, but it avoids an if at any rate... - int numToRead = (4 - (count & 3) & 3); - for(int i=0; i> ((fEncoding >= 4)?2:1); - int curPos = 0; - for (int i = 0; i < numChars; i++) { - int b0 = fBuffer[curPos++] & 0xff; - int b1 = fBuffer[curPos++] & 0xff; - if(fEncoding >=4) { - int b2 = fBuffer[curPos++] & 0xff; - int b3 = fBuffer[curPos++] & 0xff; - if (fEncoding == UCS4BE) - ch[offset+i] = (char)((b0<<24)+(b1<<16)+(b2<<8)+b3); - else - ch[offset+i] = (char)((b3<<24)+(b2<<16)+(b1<<8)+b0); - } else { // UCS-2 - if (fEncoding == UCS2BE) - ch[offset+i] = (char)((b0<<8)+b1); - else - ch[offset+i] = (char)((b1<<8)+b0); - } - } - return numChars; - } // read(char[],int,int) - - /** - * Skip characters. This method will block until some characters are - * available, an I/O error occurs, or the end of the stream is reached. - * - * @param n The number of characters to skip - * - * @return The number of characters actually skipped - * - * @exception IOException If an I/O error occurs - */ - public long skip(long n) throws IOException { - // charWidth will represent the number of bits to move - // n leftward to get num of bytes to skip, and then move the result rightward - // to get num of chars effectively skipped. - // The trick with &'ing, as with elsewhere in this dcode, is - // intended to avoid an expensive use of / that might not be optimized - // away. - int charWidth = (fEncoding >=4)?2:1; - long bytesSkipped = fInputStream.skip(n<> charWidth; - return (bytesSkipped >> charWidth) + 1; - } // skip(long):long - - /** - * Tell whether this stream is ready to be read. - * - * @return True if the next read() is guaranteed not to block for input, - * false otherwise. Note that returning false does not guarantee that the - * next read will block. - * - * @exception IOException If an I/O error occurs - */ - public boolean ready() throws IOException { - return false; - } // ready() - - /** - * Tell whether this stream supports the mark() operation. - */ - public boolean markSupported() { - return fInputStream.markSupported(); - } // markSupported() - - /** - * Mark the present position in the stream. Subsequent calls to reset() - * will attempt to reposition the stream to this point. Not all - * character-input streams support the mark() operation. - * - * @param readAheadLimit Limit on the number of characters that may be - * read while still preserving the mark. After - * reading this many characters, attempting to - * reset the stream may fail. - * - * @exception IOException If the stream does not support mark(), - * or if some other I/O error occurs - */ - public void mark(int readAheadLimit) throws IOException { - fInputStream.mark(readAheadLimit); - } // mark(int) - - /** - * Reset the stream. If the stream has been marked, then attempt to - * reposition it at the mark. If the stream has not been marked, then - * attempt to reset it in some way appropriate to the particular stream, - * for example by repositioning it to its starting point. Not all - * character-input streams support the reset() operation, and some support - * reset() without supporting mark(). - * - * @exception IOException If the stream has not been marked, - * or if the mark has been invalidated, - * or if the stream does not support reset(), - * or if some other I/O error occurs - */ - public void reset() throws IOException { - fInputStream.reset(); - } // reset() - - /** - * Close the stream. Once a stream has been closed, further read(), - * ready(), mark(), or reset() invocations will throw an IOException. - * Closing a previously-closed stream, however, has no effect. - * - * @exception IOException If an I/O error occurs - */ - public void close() throws IOException { - fInputStream.close(); - } // close() - -} // class UCSReader diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/UTF8Reader.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/UTF8Reader.java deleted file mode 100644 index 9f50ed713..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/UTF8Reader.java +++ /dev/null @@ -1,635 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -package org.apache.jasper.xmlparser; - -import java.io.InputStream; -import java.io.IOException; -import java.io.Reader; -import java.io.UTFDataFormatException; -import org.apache.jasper.compiler.Localizer; - -/** - * @author Andy Clark, IBM - * - * @version $Id: UTF8Reader.java 467222 2006-10-24 03:17:11Z markt $ - */ -public class UTF8Reader - extends Reader { - - private org.apache.juli.logging.Log log= - org.apache.juli.logging.LogFactory.getLog( UTF8Reader.class ); - - // - // Constants - // - - /** Default byte buffer size (2048). */ - public static final int DEFAULT_BUFFER_SIZE = 2048; - - // debugging - - /** Debug read. */ - private static final boolean DEBUG_READ = false; - - // - // Data - // - - /** Input stream. */ - protected InputStream fInputStream; - - /** Byte buffer. */ - protected byte[] fBuffer; - - /** Offset into buffer. */ - protected int fOffset; - - /** Surrogate character. */ - private int fSurrogate = -1; - - // - // Constructors - // - - /** - * Constructs a UTF-8 reader from the specified input stream, - * buffer size and MessageFormatter. - * - * @param inputStream The input stream. - * @param size The initial buffer size. - */ - public UTF8Reader(InputStream inputStream, int size) { - fInputStream = inputStream; - fBuffer = new byte[size]; - } - - // - // Reader methods - // - - /** - * Read a single character. This method will block until a character is - * available, an I/O error occurs, or the end of the stream is reached. - * - *

Subclasses that intend to support efficient single-character input - * should override this method. - * - * @return The character read, as an integer in the range 0 to 16383 - * (0x00-0xffff), or -1 if the end of the stream has - * been reached - * - * @exception IOException If an I/O error occurs - */ - public int read() throws IOException { - - // decode character - int c = fSurrogate; - if (fSurrogate == -1) { - // NOTE: We use the index into the buffer if there are remaining - // bytes from the last block read. -Ac - int index = 0; - - // get first byte - int b0 = index == fOffset - ? fInputStream.read() : fBuffer[index++] & 0x00FF; - if (b0 == -1) { - return -1; - } - - // UTF-8: [0xxx xxxx] - // Unicode: [0000 0000] [0xxx xxxx] - if (b0 < 0x80) { - c = (char)b0; - } - - // UTF-8: [110y yyyy] [10xx xxxx] - // Unicode: [0000 0yyy] [yyxx xxxx] - else if ((b0 & 0xE0) == 0xC0) { - int b1 = index == fOffset - ? fInputStream.read() : fBuffer[index++] & 0x00FF; - if (b1 == -1) { - expectedByte(2, 2); - } - if ((b1 & 0xC0) != 0x80) { - invalidByte(2, 2, b1); - } - c = ((b0 << 6) & 0x07C0) | (b1 & 0x003F); - } - - // UTF-8: [1110 zzzz] [10yy yyyy] [10xx xxxx] - // Unicode: [zzzz yyyy] [yyxx xxxx] - else if ((b0 & 0xF0) == 0xE0) { - int b1 = index == fOffset - ? fInputStream.read() : fBuffer[index++] & 0x00FF; - if (b1 == -1) { - expectedByte(2, 3); - } - if ((b1 & 0xC0) != 0x80) { - invalidByte(2, 3, b1); - } - int b2 = index == fOffset - ? fInputStream.read() : fBuffer[index++] & 0x00FF; - if (b2 == -1) { - expectedByte(3, 3); - } - if ((b2 & 0xC0) != 0x80) { - invalidByte(3, 3, b2); - } - c = ((b0 << 12) & 0xF000) | ((b1 << 6) & 0x0FC0) | - (b2 & 0x003F); - } - - // UTF-8: [1111 0uuu] [10uu zzzz] [10yy yyyy] [10xx xxxx]* - // Unicode: [1101 10ww] [wwzz zzyy] (high surrogate) - // [1101 11yy] [yyxx xxxx] (low surrogate) - // * uuuuu = wwww + 1 - else if ((b0 & 0xF8) == 0xF0) { - int b1 = index == fOffset - ? fInputStream.read() : fBuffer[index++] & 0x00FF; - if (b1 == -1) { - expectedByte(2, 4); - } - if ((b1 & 0xC0) != 0x80) { - invalidByte(2, 3, b1); - } - int b2 = index == fOffset - ? fInputStream.read() : fBuffer[index++] & 0x00FF; - if (b2 == -1) { - expectedByte(3, 4); - } - if ((b2 & 0xC0) != 0x80) { - invalidByte(3, 3, b2); - } - int b3 = index == fOffset - ? fInputStream.read() : fBuffer[index++] & 0x00FF; - if (b3 == -1) { - expectedByte(4, 4); - } - if ((b3 & 0xC0) != 0x80) { - invalidByte(4, 4, b3); - } - int uuuuu = ((b0 << 2) & 0x001C) | ((b1 >> 4) & 0x0003); - if (uuuuu > 0x10) { - invalidSurrogate(uuuuu); - } - int wwww = uuuuu - 1; - int hs = 0xD800 | - ((wwww << 6) & 0x03C0) | ((b1 << 2) & 0x003C) | - ((b2 >> 4) & 0x0003); - int ls = 0xDC00 | ((b2 << 6) & 0x03C0) | (b3 & 0x003F); - c = hs; - fSurrogate = ls; - } - - // error - else { - invalidByte(1, 1, b0); - } - } - - // use surrogate - else { - fSurrogate = -1; - } - - // return character - if (DEBUG_READ) { - if (log.isDebugEnabled()) - log.debug("read(): 0x"+Integer.toHexString(c)); - } - return c; - - } // read():int - - /** - * Read characters into a portion of an array. This method will block - * until some input is available, an I/O error occurs, or the end of the - * stream is reached. - * - * @param ch Destination buffer - * @param offset Offset at which to start storing characters - * @param length Maximum number of characters to read - * - * @return The number of characters read, or -1 if the end of the - * stream has been reached - * - * @exception IOException If an I/O error occurs - */ - public int read(char ch[], int offset, int length) throws IOException { - - // handle surrogate - int out = offset; - if (fSurrogate != -1) { - ch[offset + 1] = (char)fSurrogate; - fSurrogate = -1; - length--; - out++; - } - - // read bytes - int count = 0; - if (fOffset == 0) { - // adjust length to read - if (length > fBuffer.length) { - length = fBuffer.length; - } - - // perform read operation - count = fInputStream.read(fBuffer, 0, length); - if (count == -1) { - return -1; - } - count += out - offset; - } - - // skip read; last character was in error - // NOTE: Having an offset value other than zero means that there was - // an error in the last character read. In this case, we have - // skipped the read so we don't consume any bytes past the - // error. By signalling the error on the next block read we - // allow the method to return the most valid characters that - // it can on the previous block read. -Ac - else { - count = fOffset; - fOffset = 0; - } - - // convert bytes to characters - final int total = count; - for (int in = 0; in < total; in++) { - int b0 = fBuffer[in] & 0x00FF; - - // UTF-8: [0xxx xxxx] - // Unicode: [0000 0000] [0xxx xxxx] - if (b0 < 0x80) { - ch[out++] = (char)b0; - continue; - } - - // UTF-8: [110y yyyy] [10xx xxxx] - // Unicode: [0000 0yyy] [yyxx xxxx] - if ((b0 & 0xE0) == 0xC0) { - int b1 = -1; - if (++in < total) { - b1 = fBuffer[in] & 0x00FF; - } - else { - b1 = fInputStream.read(); - if (b1 == -1) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fOffset = 1; - return out - offset; - } - expectedByte(2, 2); - } - count++; - } - if ((b1 & 0xC0) != 0x80) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fOffset = 2; - return out - offset; - } - invalidByte(2, 2, b1); - } - int c = ((b0 << 6) & 0x07C0) | (b1 & 0x003F); - ch[out++] = (char)c; - count -= 1; - continue; - } - - // UTF-8: [1110 zzzz] [10yy yyyy] [10xx xxxx] - // Unicode: [zzzz yyyy] [yyxx xxxx] - if ((b0 & 0xF0) == 0xE0) { - int b1 = -1; - if (++in < total) { - b1 = fBuffer[in] & 0x00FF; - } - else { - b1 = fInputStream.read(); - if (b1 == -1) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fOffset = 1; - return out - offset; - } - expectedByte(2, 3); - } - count++; - } - if ((b1 & 0xC0) != 0x80) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fOffset = 2; - return out - offset; - } - invalidByte(2, 3, b1); - } - int b2 = -1; - if (++in < total) { - b2 = fBuffer[in] & 0x00FF; - } - else { - b2 = fInputStream.read(); - if (b2 == -1) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fOffset = 2; - return out - offset; - } - expectedByte(3, 3); - } - count++; - } - if ((b2 & 0xC0) != 0x80) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fBuffer[2] = (byte)b2; - fOffset = 3; - return out - offset; - } - invalidByte(3, 3, b2); - } - int c = ((b0 << 12) & 0xF000) | ((b1 << 6) & 0x0FC0) | - (b2 & 0x003F); - ch[out++] = (char)c; - count -= 2; - continue; - } - - // UTF-8: [1111 0uuu] [10uu zzzz] [10yy yyyy] [10xx xxxx]* - // Unicode: [1101 10ww] [wwzz zzyy] (high surrogate) - // [1101 11yy] [yyxx xxxx] (low surrogate) - // * uuuuu = wwww + 1 - if ((b0 & 0xF8) == 0xF0) { - int b1 = -1; - if (++in < total) { - b1 = fBuffer[in] & 0x00FF; - } - else { - b1 = fInputStream.read(); - if (b1 == -1) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fOffset = 1; - return out - offset; - } - expectedByte(2, 4); - } - count++; - } - if ((b1 & 0xC0) != 0x80) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fOffset = 2; - return out - offset; - } - invalidByte(2, 4, b1); - } - int b2 = -1; - if (++in < total) { - b2 = fBuffer[in] & 0x00FF; - } - else { - b2 = fInputStream.read(); - if (b2 == -1) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fOffset = 2; - return out - offset; - } - expectedByte(3, 4); - } - count++; - } - if ((b2 & 0xC0) != 0x80) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fBuffer[2] = (byte)b2; - fOffset = 3; - return out - offset; - } - invalidByte(3, 4, b2); - } - int b3 = -1; - if (++in < total) { - b3 = fBuffer[in] & 0x00FF; - } - else { - b3 = fInputStream.read(); - if (b3 == -1) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fBuffer[2] = (byte)b2; - fOffset = 3; - return out - offset; - } - expectedByte(4, 4); - } - count++; - } - if ((b3 & 0xC0) != 0x80) { - if (out > offset) { - fBuffer[0] = (byte)b0; - fBuffer[1] = (byte)b1; - fBuffer[2] = (byte)b2; - fBuffer[3] = (byte)b3; - fOffset = 4; - return out - offset; - } - invalidByte(4, 4, b2); - } - - // decode bytes into surrogate characters - int uuuuu = ((b0 << 2) & 0x001C) | ((b1 >> 4) & 0x0003); - if (uuuuu > 0x10) { - invalidSurrogate(uuuuu); - } - int wwww = uuuuu - 1; - int zzzz = b1 & 0x000F; - int yyyyyy = b2 & 0x003F; - int xxxxxx = b3 & 0x003F; - int hs = 0xD800 | ((wwww << 6) & 0x03C0) | (zzzz << 2) | (yyyyyy >> 4); - int ls = 0xDC00 | ((yyyyyy << 6) & 0x03C0) | xxxxxx; - - // set characters - ch[out++] = (char)hs; - ch[out++] = (char)ls; - count -= 2; - continue; - } - - // error - if (out > offset) { - fBuffer[0] = (byte)b0; - fOffset = 1; - return out - offset; - } - invalidByte(1, 1, b0); - } - - // return number of characters converted - if (DEBUG_READ) { - if (log.isDebugEnabled()) - log.debug("read(char[],"+offset+','+length+"): count="+count); - } - return count; - - } // read(char[],int,int) - - /** - * Skip characters. This method will block until some characters are - * available, an I/O error occurs, or the end of the stream is reached. - * - * @param n The number of characters to skip - * - * @return The number of characters actually skipped - * - * @exception IOException If an I/O error occurs - */ - public long skip(long n) throws IOException { - - long remaining = n; - final char[] ch = new char[fBuffer.length]; - do { - int length = ch.length < remaining ? ch.length : (int)remaining; - int count = read(ch, 0, length); - if (count > 0) { - remaining -= count; - } - else { - break; - } - } while (remaining > 0); - - long skipped = n - remaining; - return skipped; - - } // skip(long):long - - /** - * Tell whether this stream is ready to be read. - * - * @return True if the next read() is guaranteed not to block for input, - * false otherwise. Note that returning false does not guarantee that the - * next read will block. - * - * @exception IOException If an I/O error occurs - */ - public boolean ready() throws IOException { - return false; - } // ready() - - /** - * Tell whether this stream supports the mark() operation. - */ - public boolean markSupported() { - return false; - } // markSupported() - - /** - * Mark the present position in the stream. Subsequent calls to reset() - * will attempt to reposition the stream to this point. Not all - * character-input streams support the mark() operation. - * - * @param readAheadLimit Limit on the number of characters that may be - * read while still preserving the mark. After - * reading this many characters, attempting to - * reset the stream may fail. - * - * @exception IOException If the stream does not support mark(), - * or if some other I/O error occurs - */ - public void mark(int readAheadLimit) throws IOException { - throw new IOException( - Localizer.getMessage("jsp.error.xml.operationNotSupported", - "mark()", "UTF-8")); - } - - /** - * Reset the stream. If the stream has been marked, then attempt to - * reposition it at the mark. If the stream has not been marked, then - * attempt to reset it in some way appropriate to the particular stream, - * for example by repositioning it to its starting point. Not all - * character-input streams support the reset() operation, and some support - * reset() without supporting mark(). - * - * @exception IOException If the stream has not been marked, - * or if the mark has been invalidated, - * or if the stream does not support reset(), - * or if some other I/O error occurs - */ - public void reset() throws IOException { - fOffset = 0; - fSurrogate = -1; - } // reset() - - /** - * Close the stream. Once a stream has been closed, further read(), - * ready(), mark(), or reset() invocations will throw an IOException. - * Closing a previously-closed stream, however, has no effect. - * - * @exception IOException If an I/O error occurs - */ - public void close() throws IOException { - fInputStream.close(); - } // close() - - // - // Private methods - // - - /** Throws an exception for expected byte. */ - private void expectedByte(int position, int count) - throws UTFDataFormatException { - - throw new UTFDataFormatException( - Localizer.getMessage("jsp.error.xml.expectedByte", - Integer.toString(position), - Integer.toString(count))); - - } // expectedByte(int,int,int) - - /** Throws an exception for invalid byte. */ - private void invalidByte(int position, int count, int c) - throws UTFDataFormatException { - - throw new UTFDataFormatException( - Localizer.getMessage("jsp.error.xml.invalidByte", - Integer.toString(position), - Integer.toString(count))); - } // invalidByte(int,int,int,int) - - /** Throws an exception for invalid surrogate bits. */ - private void invalidSurrogate(int uuuuu) throws UTFDataFormatException { - - throw new UTFDataFormatException( - Localizer.getMessage("jsp.error.xml.invalidHighSurrogate", - Integer.toHexString(uuuuu))); - } // invalidSurrogate(int) - -} // class UTF8Reader diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLChar.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLChar.java deleted file mode 100644 index 16f34a40e..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLChar.java +++ /dev/null @@ -1,1031 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - * ==================================================================== - * - * This software consists of voluntary contributions made by many - * individuals on behalf of the Apache Software Foundation and was - * originally based on software copyright (c) 1999, International - * Business Machines, Inc., http://www.apache.org. For more - * information on the Apache Software Foundation, please see - * . - */ - -package org.apache.jasper.xmlparser; - -import java.util.Arrays; - -/** - * This class defines the basic XML character properties. The data - * in this class can be used to verify that a character is a valid - * XML character or if the character is a space, name start, or name - * character. - *

- * A series of convenience methods are supplied to ease the burden - * of the developer. Because inlining the checks can improve per - * character performance, the tables of character properties are - * public. Using the character as an index into the CHARS - * array and applying the appropriate mask flag (e.g. - * MASK_VALID), yields the same results as calling the - * convenience methods. There is one exception: check the comments - * for the isValid method for details. - * - * @author Glenn Marcy, IBM - * @author Andy Clark, IBM - * @author Eric Ye, IBM - * @author Arnaud Le Hors, IBM - * @author Michael Glavassevich, IBM - * @author Rahul Srivastava, Sun Microsystems Inc. - * - * @version $Id: XMLChar.java 467222 2006-10-24 03:17:11Z markt $ - */ -public class XMLChar { - - // - // Constants - // - - /** Character flags. */ - private static final byte[] CHARS = new byte[1 << 16]; - - /** Valid character mask. */ - public static final int MASK_VALID = 0x01; - - /** Space character mask. */ - public static final int MASK_SPACE = 0x02; - - /** Name start character mask. */ - public static final int MASK_NAME_START = 0x04; - - /** Name character mask. */ - public static final int MASK_NAME = 0x08; - - /** Pubid character mask. */ - public static final int MASK_PUBID = 0x10; - - /** - * Content character mask. Special characters are those that can - * be considered the start of markup, such as '<' and '&'. - * The various newline characters are considered special as well. - * All other valid XML characters can be considered content. - *

- * This is an optimization for the inner loop of character scanning. - */ - public static final int MASK_CONTENT = 0x20; - - /** NCName start character mask. */ - public static final int MASK_NCNAME_START = 0x40; - - /** NCName character mask. */ - public static final int MASK_NCNAME = 0x80; - - // - // Static initialization - // - - static { - - // Initializing the Character Flag Array - // Code generated by: XMLCharGenerator. - - CHARS[9] = 35; - CHARS[10] = 19; - CHARS[13] = 19; - CHARS[32] = 51; - CHARS[33] = 49; - CHARS[34] = 33; - Arrays.fill(CHARS, 35, 38, (byte) 49 ); // Fill 3 of value (byte) 49 - CHARS[38] = 1; - Arrays.fill(CHARS, 39, 45, (byte) 49 ); // Fill 6 of value (byte) 49 - Arrays.fill(CHARS, 45, 47, (byte) -71 ); // Fill 2 of value (byte) -71 - CHARS[47] = 49; - Arrays.fill(CHARS, 48, 58, (byte) -71 ); // Fill 10 of value (byte) -71 - CHARS[58] = 61; - CHARS[59] = 49; - CHARS[60] = 1; - CHARS[61] = 49; - CHARS[62] = 33; - Arrays.fill(CHARS, 63, 65, (byte) 49 ); // Fill 2 of value (byte) 49 - Arrays.fill(CHARS, 65, 91, (byte) -3 ); // Fill 26 of value (byte) -3 - Arrays.fill(CHARS, 91, 93, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[93] = 1; - CHARS[94] = 33; - CHARS[95] = -3; - CHARS[96] = 33; - Arrays.fill(CHARS, 97, 123, (byte) -3 ); // Fill 26 of value (byte) -3 - Arrays.fill(CHARS, 123, 183, (byte) 33 ); // Fill 60 of value (byte) 33 - CHARS[183] = -87; - Arrays.fill(CHARS, 184, 192, (byte) 33 ); // Fill 8 of value (byte) 33 - Arrays.fill(CHARS, 192, 215, (byte) -19 ); // Fill 23 of value (byte) -19 - CHARS[215] = 33; - Arrays.fill(CHARS, 216, 247, (byte) -19 ); // Fill 31 of value (byte) -19 - CHARS[247] = 33; - Arrays.fill(CHARS, 248, 306, (byte) -19 ); // Fill 58 of value (byte) -19 - Arrays.fill(CHARS, 306, 308, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 308, 319, (byte) -19 ); // Fill 11 of value (byte) -19 - Arrays.fill(CHARS, 319, 321, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 321, 329, (byte) -19 ); // Fill 8 of value (byte) -19 - CHARS[329] = 33; - Arrays.fill(CHARS, 330, 383, (byte) -19 ); // Fill 53 of value (byte) -19 - CHARS[383] = 33; - Arrays.fill(CHARS, 384, 452, (byte) -19 ); // Fill 68 of value (byte) -19 - Arrays.fill(CHARS, 452, 461, (byte) 33 ); // Fill 9 of value (byte) 33 - Arrays.fill(CHARS, 461, 497, (byte) -19 ); // Fill 36 of value (byte) -19 - Arrays.fill(CHARS, 497, 500, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 500, 502, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 502, 506, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 506, 536, (byte) -19 ); // Fill 30 of value (byte) -19 - Arrays.fill(CHARS, 536, 592, (byte) 33 ); // Fill 56 of value (byte) 33 - Arrays.fill(CHARS, 592, 681, (byte) -19 ); // Fill 89 of value (byte) -19 - Arrays.fill(CHARS, 681, 699, (byte) 33 ); // Fill 18 of value (byte) 33 - Arrays.fill(CHARS, 699, 706, (byte) -19 ); // Fill 7 of value (byte) -19 - Arrays.fill(CHARS, 706, 720, (byte) 33 ); // Fill 14 of value (byte) 33 - Arrays.fill(CHARS, 720, 722, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 722, 768, (byte) 33 ); // Fill 46 of value (byte) 33 - Arrays.fill(CHARS, 768, 838, (byte) -87 ); // Fill 70 of value (byte) -87 - Arrays.fill(CHARS, 838, 864, (byte) 33 ); // Fill 26 of value (byte) 33 - Arrays.fill(CHARS, 864, 866, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 866, 902, (byte) 33 ); // Fill 36 of value (byte) 33 - CHARS[902] = -19; - CHARS[903] = -87; - Arrays.fill(CHARS, 904, 907, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[907] = 33; - CHARS[908] = -19; - CHARS[909] = 33; - Arrays.fill(CHARS, 910, 930, (byte) -19 ); // Fill 20 of value (byte) -19 - CHARS[930] = 33; - Arrays.fill(CHARS, 931, 975, (byte) -19 ); // Fill 44 of value (byte) -19 - CHARS[975] = 33; - Arrays.fill(CHARS, 976, 983, (byte) -19 ); // Fill 7 of value (byte) -19 - Arrays.fill(CHARS, 983, 986, (byte) 33 ); // Fill 3 of value (byte) 33 - CHARS[986] = -19; - CHARS[987] = 33; - CHARS[988] = -19; - CHARS[989] = 33; - CHARS[990] = -19; - CHARS[991] = 33; - CHARS[992] = -19; - CHARS[993] = 33; - Arrays.fill(CHARS, 994, 1012, (byte) -19 ); // Fill 18 of value (byte) -19 - Arrays.fill(CHARS, 1012, 1025, (byte) 33 ); // Fill 13 of value (byte) 33 - Arrays.fill(CHARS, 1025, 1037, (byte) -19 ); // Fill 12 of value (byte) -19 - CHARS[1037] = 33; - Arrays.fill(CHARS, 1038, 1104, (byte) -19 ); // Fill 66 of value (byte) -19 - CHARS[1104] = 33; - Arrays.fill(CHARS, 1105, 1117, (byte) -19 ); // Fill 12 of value (byte) -19 - CHARS[1117] = 33; - Arrays.fill(CHARS, 1118, 1154, (byte) -19 ); // Fill 36 of value (byte) -19 - CHARS[1154] = 33; - Arrays.fill(CHARS, 1155, 1159, (byte) -87 ); // Fill 4 of value (byte) -87 - Arrays.fill(CHARS, 1159, 1168, (byte) 33 ); // Fill 9 of value (byte) 33 - Arrays.fill(CHARS, 1168, 1221, (byte) -19 ); // Fill 53 of value (byte) -19 - Arrays.fill(CHARS, 1221, 1223, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 1223, 1225, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 1225, 1227, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 1227, 1229, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 1229, 1232, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 1232, 1260, (byte) -19 ); // Fill 28 of value (byte) -19 - Arrays.fill(CHARS, 1260, 1262, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 1262, 1270, (byte) -19 ); // Fill 8 of value (byte) -19 - Arrays.fill(CHARS, 1270, 1272, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 1272, 1274, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 1274, 1329, (byte) 33 ); // Fill 55 of value (byte) 33 - Arrays.fill(CHARS, 1329, 1367, (byte) -19 ); // Fill 38 of value (byte) -19 - Arrays.fill(CHARS, 1367, 1369, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[1369] = -19; - Arrays.fill(CHARS, 1370, 1377, (byte) 33 ); // Fill 7 of value (byte) 33 - Arrays.fill(CHARS, 1377, 1415, (byte) -19 ); // Fill 38 of value (byte) -19 - Arrays.fill(CHARS, 1415, 1425, (byte) 33 ); // Fill 10 of value (byte) 33 - Arrays.fill(CHARS, 1425, 1442, (byte) -87 ); // Fill 17 of value (byte) -87 - CHARS[1442] = 33; - Arrays.fill(CHARS, 1443, 1466, (byte) -87 ); // Fill 23 of value (byte) -87 - CHARS[1466] = 33; - Arrays.fill(CHARS, 1467, 1470, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[1470] = 33; - CHARS[1471] = -87; - CHARS[1472] = 33; - Arrays.fill(CHARS, 1473, 1475, (byte) -87 ); // Fill 2 of value (byte) -87 - CHARS[1475] = 33; - CHARS[1476] = -87; - Arrays.fill(CHARS, 1477, 1488, (byte) 33 ); // Fill 11 of value (byte) 33 - Arrays.fill(CHARS, 1488, 1515, (byte) -19 ); // Fill 27 of value (byte) -19 - Arrays.fill(CHARS, 1515, 1520, (byte) 33 ); // Fill 5 of value (byte) 33 - Arrays.fill(CHARS, 1520, 1523, (byte) -19 ); // Fill 3 of value (byte) -19 - Arrays.fill(CHARS, 1523, 1569, (byte) 33 ); // Fill 46 of value (byte) 33 - Arrays.fill(CHARS, 1569, 1595, (byte) -19 ); // Fill 26 of value (byte) -19 - Arrays.fill(CHARS, 1595, 1600, (byte) 33 ); // Fill 5 of value (byte) 33 - CHARS[1600] = -87; - Arrays.fill(CHARS, 1601, 1611, (byte) -19 ); // Fill 10 of value (byte) -19 - Arrays.fill(CHARS, 1611, 1619, (byte) -87 ); // Fill 8 of value (byte) -87 - Arrays.fill(CHARS, 1619, 1632, (byte) 33 ); // Fill 13 of value (byte) 33 - Arrays.fill(CHARS, 1632, 1642, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 1642, 1648, (byte) 33 ); // Fill 6 of value (byte) 33 - CHARS[1648] = -87; - Arrays.fill(CHARS, 1649, 1720, (byte) -19 ); // Fill 71 of value (byte) -19 - Arrays.fill(CHARS, 1720, 1722, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 1722, 1727, (byte) -19 ); // Fill 5 of value (byte) -19 - CHARS[1727] = 33; - Arrays.fill(CHARS, 1728, 1743, (byte) -19 ); // Fill 15 of value (byte) -19 - CHARS[1743] = 33; - Arrays.fill(CHARS, 1744, 1748, (byte) -19 ); // Fill 4 of value (byte) -19 - CHARS[1748] = 33; - CHARS[1749] = -19; - Arrays.fill(CHARS, 1750, 1765, (byte) -87 ); // Fill 15 of value (byte) -87 - Arrays.fill(CHARS, 1765, 1767, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 1767, 1769, (byte) -87 ); // Fill 2 of value (byte) -87 - CHARS[1769] = 33; - Arrays.fill(CHARS, 1770, 1774, (byte) -87 ); // Fill 4 of value (byte) -87 - Arrays.fill(CHARS, 1774, 1776, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 1776, 1786, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 1786, 2305, (byte) 33 ); // Fill 519 of value (byte) 33 - Arrays.fill(CHARS, 2305, 2308, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[2308] = 33; - Arrays.fill(CHARS, 2309, 2362, (byte) -19 ); // Fill 53 of value (byte) -19 - Arrays.fill(CHARS, 2362, 2364, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[2364] = -87; - CHARS[2365] = -19; - Arrays.fill(CHARS, 2366, 2382, (byte) -87 ); // Fill 16 of value (byte) -87 - Arrays.fill(CHARS, 2382, 2385, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2385, 2389, (byte) -87 ); // Fill 4 of value (byte) -87 - Arrays.fill(CHARS, 2389, 2392, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2392, 2402, (byte) -19 ); // Fill 10 of value (byte) -19 - Arrays.fill(CHARS, 2402, 2404, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 2404, 2406, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2406, 2416, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 2416, 2433, (byte) 33 ); // Fill 17 of value (byte) 33 - Arrays.fill(CHARS, 2433, 2436, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[2436] = 33; - Arrays.fill(CHARS, 2437, 2445, (byte) -19 ); // Fill 8 of value (byte) -19 - Arrays.fill(CHARS, 2445, 2447, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2447, 2449, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2449, 2451, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2451, 2473, (byte) -19 ); // Fill 22 of value (byte) -19 - CHARS[2473] = 33; - Arrays.fill(CHARS, 2474, 2481, (byte) -19 ); // Fill 7 of value (byte) -19 - CHARS[2481] = 33; - CHARS[2482] = -19; - Arrays.fill(CHARS, 2483, 2486, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2486, 2490, (byte) -19 ); // Fill 4 of value (byte) -19 - Arrays.fill(CHARS, 2490, 2492, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[2492] = -87; - CHARS[2493] = 33; - Arrays.fill(CHARS, 2494, 2501, (byte) -87 ); // Fill 7 of value (byte) -87 - Arrays.fill(CHARS, 2501, 2503, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2503, 2505, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 2505, 2507, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2507, 2510, (byte) -87 ); // Fill 3 of value (byte) -87 - Arrays.fill(CHARS, 2510, 2519, (byte) 33 ); // Fill 9 of value (byte) 33 - CHARS[2519] = -87; - Arrays.fill(CHARS, 2520, 2524, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 2524, 2526, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[2526] = 33; - Arrays.fill(CHARS, 2527, 2530, (byte) -19 ); // Fill 3 of value (byte) -19 - Arrays.fill(CHARS, 2530, 2532, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 2532, 2534, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2534, 2544, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 2544, 2546, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2546, 2562, (byte) 33 ); // Fill 16 of value (byte) 33 - CHARS[2562] = -87; - Arrays.fill(CHARS, 2563, 2565, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2565, 2571, (byte) -19 ); // Fill 6 of value (byte) -19 - Arrays.fill(CHARS, 2571, 2575, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 2575, 2577, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2577, 2579, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2579, 2601, (byte) -19 ); // Fill 22 of value (byte) -19 - CHARS[2601] = 33; - Arrays.fill(CHARS, 2602, 2609, (byte) -19 ); // Fill 7 of value (byte) -19 - CHARS[2609] = 33; - Arrays.fill(CHARS, 2610, 2612, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[2612] = 33; - Arrays.fill(CHARS, 2613, 2615, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[2615] = 33; - Arrays.fill(CHARS, 2616, 2618, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2618, 2620, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[2620] = -87; - CHARS[2621] = 33; - Arrays.fill(CHARS, 2622, 2627, (byte) -87 ); // Fill 5 of value (byte) -87 - Arrays.fill(CHARS, 2627, 2631, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 2631, 2633, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 2633, 2635, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2635, 2638, (byte) -87 ); // Fill 3 of value (byte) -87 - Arrays.fill(CHARS, 2638, 2649, (byte) 33 ); // Fill 11 of value (byte) 33 - Arrays.fill(CHARS, 2649, 2653, (byte) -19 ); // Fill 4 of value (byte) -19 - CHARS[2653] = 33; - CHARS[2654] = -19; - Arrays.fill(CHARS, 2655, 2662, (byte) 33 ); // Fill 7 of value (byte) 33 - Arrays.fill(CHARS, 2662, 2674, (byte) -87 ); // Fill 12 of value (byte) -87 - Arrays.fill(CHARS, 2674, 2677, (byte) -19 ); // Fill 3 of value (byte) -19 - Arrays.fill(CHARS, 2677, 2689, (byte) 33 ); // Fill 12 of value (byte) 33 - Arrays.fill(CHARS, 2689, 2692, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[2692] = 33; - Arrays.fill(CHARS, 2693, 2700, (byte) -19 ); // Fill 7 of value (byte) -19 - CHARS[2700] = 33; - CHARS[2701] = -19; - CHARS[2702] = 33; - Arrays.fill(CHARS, 2703, 2706, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[2706] = 33; - Arrays.fill(CHARS, 2707, 2729, (byte) -19 ); // Fill 22 of value (byte) -19 - CHARS[2729] = 33; - Arrays.fill(CHARS, 2730, 2737, (byte) -19 ); // Fill 7 of value (byte) -19 - CHARS[2737] = 33; - Arrays.fill(CHARS, 2738, 2740, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[2740] = 33; - Arrays.fill(CHARS, 2741, 2746, (byte) -19 ); // Fill 5 of value (byte) -19 - Arrays.fill(CHARS, 2746, 2748, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[2748] = -87; - CHARS[2749] = -19; - Arrays.fill(CHARS, 2750, 2758, (byte) -87 ); // Fill 8 of value (byte) -87 - CHARS[2758] = 33; - Arrays.fill(CHARS, 2759, 2762, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[2762] = 33; - Arrays.fill(CHARS, 2763, 2766, (byte) -87 ); // Fill 3 of value (byte) -87 - Arrays.fill(CHARS, 2766, 2784, (byte) 33 ); // Fill 18 of value (byte) 33 - CHARS[2784] = -19; - Arrays.fill(CHARS, 2785, 2790, (byte) 33 ); // Fill 5 of value (byte) 33 - Arrays.fill(CHARS, 2790, 2800, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 2800, 2817, (byte) 33 ); // Fill 17 of value (byte) 33 - Arrays.fill(CHARS, 2817, 2820, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[2820] = 33; - Arrays.fill(CHARS, 2821, 2829, (byte) -19 ); // Fill 8 of value (byte) -19 - Arrays.fill(CHARS, 2829, 2831, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2831, 2833, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2833, 2835, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2835, 2857, (byte) -19 ); // Fill 22 of value (byte) -19 - CHARS[2857] = 33; - Arrays.fill(CHARS, 2858, 2865, (byte) -19 ); // Fill 7 of value (byte) -19 - CHARS[2865] = 33; - Arrays.fill(CHARS, 2866, 2868, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2868, 2870, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2870, 2874, (byte) -19 ); // Fill 4 of value (byte) -19 - Arrays.fill(CHARS, 2874, 2876, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[2876] = -87; - CHARS[2877] = -19; - Arrays.fill(CHARS, 2878, 2884, (byte) -87 ); // Fill 6 of value (byte) -87 - Arrays.fill(CHARS, 2884, 2887, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2887, 2889, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 2889, 2891, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 2891, 2894, (byte) -87 ); // Fill 3 of value (byte) -87 - Arrays.fill(CHARS, 2894, 2902, (byte) 33 ); // Fill 8 of value (byte) 33 - Arrays.fill(CHARS, 2902, 2904, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 2904, 2908, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 2908, 2910, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[2910] = 33; - Arrays.fill(CHARS, 2911, 2914, (byte) -19 ); // Fill 3 of value (byte) -19 - Arrays.fill(CHARS, 2914, 2918, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 2918, 2928, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 2928, 2946, (byte) 33 ); // Fill 18 of value (byte) 33 - Arrays.fill(CHARS, 2946, 2948, (byte) -87 ); // Fill 2 of value (byte) -87 - CHARS[2948] = 33; - Arrays.fill(CHARS, 2949, 2955, (byte) -19 ); // Fill 6 of value (byte) -19 - Arrays.fill(CHARS, 2955, 2958, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2958, 2961, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[2961] = 33; - Arrays.fill(CHARS, 2962, 2966, (byte) -19 ); // Fill 4 of value (byte) -19 - Arrays.fill(CHARS, 2966, 2969, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2969, 2971, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[2971] = 33; - CHARS[2972] = -19; - CHARS[2973] = 33; - Arrays.fill(CHARS, 2974, 2976, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2976, 2979, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2979, 2981, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 2981, 2984, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2984, 2987, (byte) -19 ); // Fill 3 of value (byte) -19 - Arrays.fill(CHARS, 2987, 2990, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 2990, 2998, (byte) -19 ); // Fill 8 of value (byte) -19 - CHARS[2998] = 33; - Arrays.fill(CHARS, 2999, 3002, (byte) -19 ); // Fill 3 of value (byte) -19 - Arrays.fill(CHARS, 3002, 3006, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3006, 3011, (byte) -87 ); // Fill 5 of value (byte) -87 - Arrays.fill(CHARS, 3011, 3014, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 3014, 3017, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[3017] = 33; - Arrays.fill(CHARS, 3018, 3022, (byte) -87 ); // Fill 4 of value (byte) -87 - Arrays.fill(CHARS, 3022, 3031, (byte) 33 ); // Fill 9 of value (byte) 33 - CHARS[3031] = -87; - Arrays.fill(CHARS, 3032, 3047, (byte) 33 ); // Fill 15 of value (byte) 33 - Arrays.fill(CHARS, 3047, 3056, (byte) -87 ); // Fill 9 of value (byte) -87 - Arrays.fill(CHARS, 3056, 3073, (byte) 33 ); // Fill 17 of value (byte) 33 - Arrays.fill(CHARS, 3073, 3076, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[3076] = 33; - Arrays.fill(CHARS, 3077, 3085, (byte) -19 ); // Fill 8 of value (byte) -19 - CHARS[3085] = 33; - Arrays.fill(CHARS, 3086, 3089, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[3089] = 33; - Arrays.fill(CHARS, 3090, 3113, (byte) -19 ); // Fill 23 of value (byte) -19 - CHARS[3113] = 33; - Arrays.fill(CHARS, 3114, 3124, (byte) -19 ); // Fill 10 of value (byte) -19 - CHARS[3124] = 33; - Arrays.fill(CHARS, 3125, 3130, (byte) -19 ); // Fill 5 of value (byte) -19 - Arrays.fill(CHARS, 3130, 3134, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3134, 3141, (byte) -87 ); // Fill 7 of value (byte) -87 - CHARS[3141] = 33; - Arrays.fill(CHARS, 3142, 3145, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[3145] = 33; - Arrays.fill(CHARS, 3146, 3150, (byte) -87 ); // Fill 4 of value (byte) -87 - Arrays.fill(CHARS, 3150, 3157, (byte) 33 ); // Fill 7 of value (byte) 33 - Arrays.fill(CHARS, 3157, 3159, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 3159, 3168, (byte) 33 ); // Fill 9 of value (byte) 33 - Arrays.fill(CHARS, 3168, 3170, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 3170, 3174, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3174, 3184, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 3184, 3202, (byte) 33 ); // Fill 18 of value (byte) 33 - Arrays.fill(CHARS, 3202, 3204, (byte) -87 ); // Fill 2 of value (byte) -87 - CHARS[3204] = 33; - Arrays.fill(CHARS, 3205, 3213, (byte) -19 ); // Fill 8 of value (byte) -19 - CHARS[3213] = 33; - Arrays.fill(CHARS, 3214, 3217, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[3217] = 33; - Arrays.fill(CHARS, 3218, 3241, (byte) -19 ); // Fill 23 of value (byte) -19 - CHARS[3241] = 33; - Arrays.fill(CHARS, 3242, 3252, (byte) -19 ); // Fill 10 of value (byte) -19 - CHARS[3252] = 33; - Arrays.fill(CHARS, 3253, 3258, (byte) -19 ); // Fill 5 of value (byte) -19 - Arrays.fill(CHARS, 3258, 3262, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3262, 3269, (byte) -87 ); // Fill 7 of value (byte) -87 - CHARS[3269] = 33; - Arrays.fill(CHARS, 3270, 3273, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[3273] = 33; - Arrays.fill(CHARS, 3274, 3278, (byte) -87 ); // Fill 4 of value (byte) -87 - Arrays.fill(CHARS, 3278, 3285, (byte) 33 ); // Fill 7 of value (byte) 33 - Arrays.fill(CHARS, 3285, 3287, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 3287, 3294, (byte) 33 ); // Fill 7 of value (byte) 33 - CHARS[3294] = -19; - CHARS[3295] = 33; - Arrays.fill(CHARS, 3296, 3298, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 3298, 3302, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3302, 3312, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 3312, 3330, (byte) 33 ); // Fill 18 of value (byte) 33 - Arrays.fill(CHARS, 3330, 3332, (byte) -87 ); // Fill 2 of value (byte) -87 - CHARS[3332] = 33; - Arrays.fill(CHARS, 3333, 3341, (byte) -19 ); // Fill 8 of value (byte) -19 - CHARS[3341] = 33; - Arrays.fill(CHARS, 3342, 3345, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[3345] = 33; - Arrays.fill(CHARS, 3346, 3369, (byte) -19 ); // Fill 23 of value (byte) -19 - CHARS[3369] = 33; - Arrays.fill(CHARS, 3370, 3386, (byte) -19 ); // Fill 16 of value (byte) -19 - Arrays.fill(CHARS, 3386, 3390, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3390, 3396, (byte) -87 ); // Fill 6 of value (byte) -87 - Arrays.fill(CHARS, 3396, 3398, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 3398, 3401, (byte) -87 ); // Fill 3 of value (byte) -87 - CHARS[3401] = 33; - Arrays.fill(CHARS, 3402, 3406, (byte) -87 ); // Fill 4 of value (byte) -87 - Arrays.fill(CHARS, 3406, 3415, (byte) 33 ); // Fill 9 of value (byte) 33 - CHARS[3415] = -87; - Arrays.fill(CHARS, 3416, 3424, (byte) 33 ); // Fill 8 of value (byte) 33 - Arrays.fill(CHARS, 3424, 3426, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 3426, 3430, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3430, 3440, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 3440, 3585, (byte) 33 ); // Fill 145 of value (byte) 33 - Arrays.fill(CHARS, 3585, 3631, (byte) -19 ); // Fill 46 of value (byte) -19 - CHARS[3631] = 33; - CHARS[3632] = -19; - CHARS[3633] = -87; - Arrays.fill(CHARS, 3634, 3636, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 3636, 3643, (byte) -87 ); // Fill 7 of value (byte) -87 - Arrays.fill(CHARS, 3643, 3648, (byte) 33 ); // Fill 5 of value (byte) 33 - Arrays.fill(CHARS, 3648, 3654, (byte) -19 ); // Fill 6 of value (byte) -19 - Arrays.fill(CHARS, 3654, 3663, (byte) -87 ); // Fill 9 of value (byte) -87 - CHARS[3663] = 33; - Arrays.fill(CHARS, 3664, 3674, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 3674, 3713, (byte) 33 ); // Fill 39 of value (byte) 33 - Arrays.fill(CHARS, 3713, 3715, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[3715] = 33; - CHARS[3716] = -19; - Arrays.fill(CHARS, 3717, 3719, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 3719, 3721, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[3721] = 33; - CHARS[3722] = -19; - Arrays.fill(CHARS, 3723, 3725, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[3725] = -19; - Arrays.fill(CHARS, 3726, 3732, (byte) 33 ); // Fill 6 of value (byte) 33 - Arrays.fill(CHARS, 3732, 3736, (byte) -19 ); // Fill 4 of value (byte) -19 - CHARS[3736] = 33; - Arrays.fill(CHARS, 3737, 3744, (byte) -19 ); // Fill 7 of value (byte) -19 - CHARS[3744] = 33; - Arrays.fill(CHARS, 3745, 3748, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[3748] = 33; - CHARS[3749] = -19; - CHARS[3750] = 33; - CHARS[3751] = -19; - Arrays.fill(CHARS, 3752, 3754, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 3754, 3756, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[3756] = 33; - Arrays.fill(CHARS, 3757, 3759, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[3759] = 33; - CHARS[3760] = -19; - CHARS[3761] = -87; - Arrays.fill(CHARS, 3762, 3764, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 3764, 3770, (byte) -87 ); // Fill 6 of value (byte) -87 - CHARS[3770] = 33; - Arrays.fill(CHARS, 3771, 3773, (byte) -87 ); // Fill 2 of value (byte) -87 - CHARS[3773] = -19; - Arrays.fill(CHARS, 3774, 3776, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 3776, 3781, (byte) -19 ); // Fill 5 of value (byte) -19 - CHARS[3781] = 33; - CHARS[3782] = -87; - CHARS[3783] = 33; - Arrays.fill(CHARS, 3784, 3790, (byte) -87 ); // Fill 6 of value (byte) -87 - Arrays.fill(CHARS, 3790, 3792, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 3792, 3802, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 3802, 3864, (byte) 33 ); // Fill 62 of value (byte) 33 - Arrays.fill(CHARS, 3864, 3866, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 3866, 3872, (byte) 33 ); // Fill 6 of value (byte) 33 - Arrays.fill(CHARS, 3872, 3882, (byte) -87 ); // Fill 10 of value (byte) -87 - Arrays.fill(CHARS, 3882, 3893, (byte) 33 ); // Fill 11 of value (byte) 33 - CHARS[3893] = -87; - CHARS[3894] = 33; - CHARS[3895] = -87; - CHARS[3896] = 33; - CHARS[3897] = -87; - Arrays.fill(CHARS, 3898, 3902, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3902, 3904, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 3904, 3912, (byte) -19 ); // Fill 8 of value (byte) -19 - CHARS[3912] = 33; - Arrays.fill(CHARS, 3913, 3946, (byte) -19 ); // Fill 33 of value (byte) -19 - Arrays.fill(CHARS, 3946, 3953, (byte) 33 ); // Fill 7 of value (byte) 33 - Arrays.fill(CHARS, 3953, 3973, (byte) -87 ); // Fill 20 of value (byte) -87 - CHARS[3973] = 33; - Arrays.fill(CHARS, 3974, 3980, (byte) -87 ); // Fill 6 of value (byte) -87 - Arrays.fill(CHARS, 3980, 3984, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 3984, 3990, (byte) -87 ); // Fill 6 of value (byte) -87 - CHARS[3990] = 33; - CHARS[3991] = -87; - CHARS[3992] = 33; - Arrays.fill(CHARS, 3993, 4014, (byte) -87 ); // Fill 21 of value (byte) -87 - Arrays.fill(CHARS, 4014, 4017, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 4017, 4024, (byte) -87 ); // Fill 7 of value (byte) -87 - CHARS[4024] = 33; - CHARS[4025] = -87; - Arrays.fill(CHARS, 4026, 4256, (byte) 33 ); // Fill 230 of value (byte) 33 - Arrays.fill(CHARS, 4256, 4294, (byte) -19 ); // Fill 38 of value (byte) -19 - Arrays.fill(CHARS, 4294, 4304, (byte) 33 ); // Fill 10 of value (byte) 33 - Arrays.fill(CHARS, 4304, 4343, (byte) -19 ); // Fill 39 of value (byte) -19 - Arrays.fill(CHARS, 4343, 4352, (byte) 33 ); // Fill 9 of value (byte) 33 - CHARS[4352] = -19; - CHARS[4353] = 33; - Arrays.fill(CHARS, 4354, 4356, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[4356] = 33; - Arrays.fill(CHARS, 4357, 4360, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[4360] = 33; - CHARS[4361] = -19; - CHARS[4362] = 33; - Arrays.fill(CHARS, 4363, 4365, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[4365] = 33; - Arrays.fill(CHARS, 4366, 4371, (byte) -19 ); // Fill 5 of value (byte) -19 - Arrays.fill(CHARS, 4371, 4412, (byte) 33 ); // Fill 41 of value (byte) 33 - CHARS[4412] = -19; - CHARS[4413] = 33; - CHARS[4414] = -19; - CHARS[4415] = 33; - CHARS[4416] = -19; - Arrays.fill(CHARS, 4417, 4428, (byte) 33 ); // Fill 11 of value (byte) 33 - CHARS[4428] = -19; - CHARS[4429] = 33; - CHARS[4430] = -19; - CHARS[4431] = 33; - CHARS[4432] = -19; - Arrays.fill(CHARS, 4433, 4436, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 4436, 4438, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 4438, 4441, (byte) 33 ); // Fill 3 of value (byte) 33 - CHARS[4441] = -19; - Arrays.fill(CHARS, 4442, 4447, (byte) 33 ); // Fill 5 of value (byte) 33 - Arrays.fill(CHARS, 4447, 4450, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[4450] = 33; - CHARS[4451] = -19; - CHARS[4452] = 33; - CHARS[4453] = -19; - CHARS[4454] = 33; - CHARS[4455] = -19; - CHARS[4456] = 33; - CHARS[4457] = -19; - Arrays.fill(CHARS, 4458, 4461, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 4461, 4463, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 4463, 4466, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 4466, 4468, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[4468] = 33; - CHARS[4469] = -19; - Arrays.fill(CHARS, 4470, 4510, (byte) 33 ); // Fill 40 of value (byte) 33 - CHARS[4510] = -19; - Arrays.fill(CHARS, 4511, 4520, (byte) 33 ); // Fill 9 of value (byte) 33 - CHARS[4520] = -19; - Arrays.fill(CHARS, 4521, 4523, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[4523] = -19; - Arrays.fill(CHARS, 4524, 4526, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 4526, 4528, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 4528, 4535, (byte) 33 ); // Fill 7 of value (byte) 33 - Arrays.fill(CHARS, 4535, 4537, (byte) -19 ); // Fill 2 of value (byte) -19 - CHARS[4537] = 33; - CHARS[4538] = -19; - CHARS[4539] = 33; - Arrays.fill(CHARS, 4540, 4547, (byte) -19 ); // Fill 7 of value (byte) -19 - Arrays.fill(CHARS, 4547, 4587, (byte) 33 ); // Fill 40 of value (byte) 33 - CHARS[4587] = -19; - Arrays.fill(CHARS, 4588, 4592, (byte) 33 ); // Fill 4 of value (byte) 33 - CHARS[4592] = -19; - Arrays.fill(CHARS, 4593, 4601, (byte) 33 ); // Fill 8 of value (byte) 33 - CHARS[4601] = -19; - Arrays.fill(CHARS, 4602, 7680, (byte) 33 ); // Fill 3078 of value (byte) 33 - Arrays.fill(CHARS, 7680, 7836, (byte) -19 ); // Fill 156 of value (byte) -19 - Arrays.fill(CHARS, 7836, 7840, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 7840, 7930, (byte) -19 ); // Fill 90 of value (byte) -19 - Arrays.fill(CHARS, 7930, 7936, (byte) 33 ); // Fill 6 of value (byte) 33 - Arrays.fill(CHARS, 7936, 7958, (byte) -19 ); // Fill 22 of value (byte) -19 - Arrays.fill(CHARS, 7958, 7960, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 7960, 7966, (byte) -19 ); // Fill 6 of value (byte) -19 - Arrays.fill(CHARS, 7966, 7968, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 7968, 8006, (byte) -19 ); // Fill 38 of value (byte) -19 - Arrays.fill(CHARS, 8006, 8008, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 8008, 8014, (byte) -19 ); // Fill 6 of value (byte) -19 - Arrays.fill(CHARS, 8014, 8016, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 8016, 8024, (byte) -19 ); // Fill 8 of value (byte) -19 - CHARS[8024] = 33; - CHARS[8025] = -19; - CHARS[8026] = 33; - CHARS[8027] = -19; - CHARS[8028] = 33; - CHARS[8029] = -19; - CHARS[8030] = 33; - Arrays.fill(CHARS, 8031, 8062, (byte) -19 ); // Fill 31 of value (byte) -19 - Arrays.fill(CHARS, 8062, 8064, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 8064, 8117, (byte) -19 ); // Fill 53 of value (byte) -19 - CHARS[8117] = 33; - Arrays.fill(CHARS, 8118, 8125, (byte) -19 ); // Fill 7 of value (byte) -19 - CHARS[8125] = 33; - CHARS[8126] = -19; - Arrays.fill(CHARS, 8127, 8130, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 8130, 8133, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[8133] = 33; - Arrays.fill(CHARS, 8134, 8141, (byte) -19 ); // Fill 7 of value (byte) -19 - Arrays.fill(CHARS, 8141, 8144, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 8144, 8148, (byte) -19 ); // Fill 4 of value (byte) -19 - Arrays.fill(CHARS, 8148, 8150, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 8150, 8156, (byte) -19 ); // Fill 6 of value (byte) -19 - Arrays.fill(CHARS, 8156, 8160, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 8160, 8173, (byte) -19 ); // Fill 13 of value (byte) -19 - Arrays.fill(CHARS, 8173, 8178, (byte) 33 ); // Fill 5 of value (byte) 33 - Arrays.fill(CHARS, 8178, 8181, (byte) -19 ); // Fill 3 of value (byte) -19 - CHARS[8181] = 33; - Arrays.fill(CHARS, 8182, 8189, (byte) -19 ); // Fill 7 of value (byte) -19 - Arrays.fill(CHARS, 8189, 8400, (byte) 33 ); // Fill 211 of value (byte) 33 - Arrays.fill(CHARS, 8400, 8413, (byte) -87 ); // Fill 13 of value (byte) -87 - Arrays.fill(CHARS, 8413, 8417, (byte) 33 ); // Fill 4 of value (byte) 33 - CHARS[8417] = -87; - Arrays.fill(CHARS, 8418, 8486, (byte) 33 ); // Fill 68 of value (byte) 33 - CHARS[8486] = -19; - Arrays.fill(CHARS, 8487, 8490, (byte) 33 ); // Fill 3 of value (byte) 33 - Arrays.fill(CHARS, 8490, 8492, (byte) -19 ); // Fill 2 of value (byte) -19 - Arrays.fill(CHARS, 8492, 8494, (byte) 33 ); // Fill 2 of value (byte) 33 - CHARS[8494] = -19; - Arrays.fill(CHARS, 8495, 8576, (byte) 33 ); // Fill 81 of value (byte) 33 - Arrays.fill(CHARS, 8576, 8579, (byte) -19 ); // Fill 3 of value (byte) -19 - Arrays.fill(CHARS, 8579, 12293, (byte) 33 ); // Fill 3714 of value (byte) 33 - CHARS[12293] = -87; - CHARS[12294] = 33; - CHARS[12295] = -19; - Arrays.fill(CHARS, 12296, 12321, (byte) 33 ); // Fill 25 of value (byte) 33 - Arrays.fill(CHARS, 12321, 12330, (byte) -19 ); // Fill 9 of value (byte) -19 - Arrays.fill(CHARS, 12330, 12336, (byte) -87 ); // Fill 6 of value (byte) -87 - CHARS[12336] = 33; - Arrays.fill(CHARS, 12337, 12342, (byte) -87 ); // Fill 5 of value (byte) -87 - Arrays.fill(CHARS, 12342, 12353, (byte) 33 ); // Fill 11 of value (byte) 33 - Arrays.fill(CHARS, 12353, 12437, (byte) -19 ); // Fill 84 of value (byte) -19 - Arrays.fill(CHARS, 12437, 12441, (byte) 33 ); // Fill 4 of value (byte) 33 - Arrays.fill(CHARS, 12441, 12443, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 12443, 12445, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 12445, 12447, (byte) -87 ); // Fill 2 of value (byte) -87 - Arrays.fill(CHARS, 12447, 12449, (byte) 33 ); // Fill 2 of value (byte) 33 - Arrays.fill(CHARS, 12449, 12539, (byte) -19 ); // Fill 90 of value (byte) -19 - CHARS[12539] = 33; - Arrays.fill(CHARS, 12540, 12543, (byte) -87 ); // Fill 3 of value (byte) -87 - Arrays.fill(CHARS, 12543, 12549, (byte) 33 ); // Fill 6 of value (byte) 33 - Arrays.fill(CHARS, 12549, 12589, (byte) -19 ); // Fill 40 of value (byte) -19 - Arrays.fill(CHARS, 12589, 19968, (byte) 33 ); // Fill 7379 of value (byte) 33 - Arrays.fill(CHARS, 19968, 40870, (byte) -19 ); // Fill 20902 of value (byte) -19 - Arrays.fill(CHARS, 40870, 44032, (byte) 33 ); // Fill 3162 of value (byte) 33 - Arrays.fill(CHARS, 44032, 55204, (byte) -19 ); // Fill 11172 of value (byte) -19 - Arrays.fill(CHARS, 55204, 55296, (byte) 33 ); // Fill 92 of value (byte) 33 - Arrays.fill(CHARS, 57344, 65534, (byte) 33 ); // Fill 8190 of value (byte) 33 - - } // () - - // - // Public static methods - // - - /** - * Returns true if the specified character is a supplemental character. - * - * @param c The character to check. - */ - public static boolean isSupplemental(int c) { - return (c >= 0x10000 && c <= 0x10FFFF); - } - - /** - * Returns true the supplemental character corresponding to the given - * surrogates. - * - * @param h The high surrogate. - * @param l The low surrogate. - */ - public static int supplemental(char h, char l) { - return (h - 0xD800) * 0x400 + (l - 0xDC00) + 0x10000; - } - - /** - * Returns the high surrogate of a supplemental character - * - * @param c The supplemental character to "split". - */ - public static char highSurrogate(int c) { - return (char) (((c - 0x00010000) >> 10) + 0xD800); - } - - /** - * Returns the low surrogate of a supplemental character - * - * @param c The supplemental character to "split". - */ - public static char lowSurrogate(int c) { - return (char) (((c - 0x00010000) & 0x3FF) + 0xDC00); - } - - /** - * Returns whether the given character is a high surrogate - * - * @param c The character to check. - */ - public static boolean isHighSurrogate(int c) { - return (0xD800 <= c && c <= 0xDBFF); - } - - /** - * Returns whether the given character is a low surrogate - * - * @param c The character to check. - */ - public static boolean isLowSurrogate(int c) { - return (0xDC00 <= c && c <= 0xDFFF); - } - - - /** - * Returns true if the specified character is valid. This method - * also checks the surrogate character range from 0x10000 to 0x10FFFF. - *

- * If the program chooses to apply the mask directly to the - * CHARS array, then they are responsible for checking - * the surrogate character range. - * - * @param c The character to check. - */ - public static boolean isValid(int c) { - return (c < 0x10000 && (CHARS[c] & MASK_VALID) != 0) || - (0x10000 <= c && c <= 0x10FFFF); - } // isValid(int):boolean - - /** - * Returns true if the specified character is invalid. - * - * @param c The character to check. - */ - public static boolean isInvalid(int c) { - return !isValid(c); - } // isInvalid(int):boolean - - /** - * Returns true if the specified character can be considered content. - * - * @param c The character to check. - */ - public static boolean isContent(int c) { - return (c < 0x10000 && (CHARS[c] & MASK_CONTENT) != 0) || - (0x10000 <= c && c <= 0x10FFFF); - } // isContent(int):boolean - - /** - * Returns true if the specified character can be considered markup. - * Markup characters include '<', '&', and '%'. - * - * @param c The character to check. - */ - public static boolean isMarkup(int c) { - return c == '<' || c == '&' || c == '%'; - } // isMarkup(int):boolean - - /** - * Returns true if the specified character is a space character - * as defined by production [3] in the XML 1.0 specification. - * - * @param c The character to check. - */ - public static boolean isSpace(int c) { - return c <= 0x20 && (CHARS[c] & MASK_SPACE) != 0; - } // isSpace(int):boolean - - /** - * Returns true if the specified character is a valid name start - * character as defined by production [5] in the XML 1.0 - * specification. - * - * @param c The character to check. - */ - public static boolean isNameStart(int c) { - return c < 0x10000 && (CHARS[c] & MASK_NAME_START) != 0; - } // isNameStart(int):boolean - - /** - * Returns true if the specified character is a valid name - * character as defined by production [4] in the XML 1.0 - * specification. - * - * @param c The character to check. - */ - public static boolean isName(int c) { - return c < 0x10000 && (CHARS[c] & MASK_NAME) != 0; - } // isName(int):boolean - - /** - * Returns true if the specified character is a valid NCName start - * character as defined by production [4] in Namespaces in XML - * recommendation. - * - * @param c The character to check. - */ - public static boolean isNCNameStart(int c) { - return c < 0x10000 && (CHARS[c] & MASK_NCNAME_START) != 0; - } // isNCNameStart(int):boolean - - /** - * Returns true if the specified character is a valid NCName - * character as defined by production [5] in Namespaces in XML - * recommendation. - * - * @param c The character to check. - */ - public static boolean isNCName(int c) { - return c < 0x10000 && (CHARS[c] & MASK_NCNAME) != 0; - } // isNCName(int):boolean - - /** - * Returns true if the specified character is a valid Pubid - * character as defined by production [13] in the XML 1.0 - * specification. - * - * @param c The character to check. - */ - public static boolean isPubid(int c) { - return c < 0x10000 && (CHARS[c] & MASK_PUBID) != 0; - } // isPubid(int):boolean - - /* - * [5] Name ::= (Letter | '_' | ':') (NameChar)* - */ - /** - * Check to see if a string is a valid Name according to [5] - * in the XML 1.0 Recommendation - * - * @param name string to check - * @return true if name is a valid Name - */ - public static boolean isValidName(String name) { - if (name.length() == 0) - return false; - char ch = name.charAt(0); - if( isNameStart(ch) == false) - return false; - for (int i = 1; i < name.length(); i++ ) { - ch = name.charAt(i); - if( isName( ch ) == false ){ - return false; - } - } - return true; - } // isValidName(String):boolean - - - /* - * from the namespace rec - * [4] NCName ::= (Letter | '_') (NCNameChar)* - */ - /** - * Check to see if a string is a valid NCName according to [4] - * from the XML Namespaces 1.0 Recommendation - * - * @param ncName string to check - * @return true if name is a valid NCName - */ - public static boolean isValidNCName(String ncName) { - if (ncName.length() == 0) - return false; - char ch = ncName.charAt(0); - if( isNCNameStart(ch) == false) - return false; - for (int i = 1; i < ncName.length(); i++ ) { - ch = ncName.charAt(i); - if( isNCName( ch ) == false ){ - return false; - } - } - return true; - } // isValidNCName(String):boolean - - /* - * [7] Nmtoken ::= (NameChar)+ - */ - /** - * Check to see if a string is a valid Nmtoken according to [7] - * in the XML 1.0 Recommendation - * - * @param nmtoken string to check - * @return true if nmtoken is a valid Nmtoken - */ - public static boolean isValidNmtoken(String nmtoken) { - if (nmtoken.length() == 0) - return false; - for (int i = 0; i < nmtoken.length(); i++ ) { - char ch = nmtoken.charAt(i); - if( ! isName( ch ) ){ - return false; - } - } - return true; - } // isValidName(String):boolean - - - - - - // encodings - - /** - * Returns true if the encoding name is a valid IANA encoding. - * This method does not verify that there is a decoder available - * for this encoding, only that the characters are valid for an - * IANA encoding name. - * - * @param ianaEncoding The IANA encoding name. - */ - public static boolean isValidIANAEncoding(String ianaEncoding) { - if (ianaEncoding != null) { - int length = ianaEncoding.length(); - if (length > 0) { - char c = ianaEncoding.charAt(0); - if ((c >= 'A' && c <= 'Z') || (c >= 'a' && c <= 'z')) { - for (int i = 1; i < length; i++) { - c = ianaEncoding.charAt(i); - if ((c < 'A' || c > 'Z') && (c < 'a' || c > 'z') && - (c < '0' || c > '9') && c != '.' && c != '_' && - c != '-') { - return false; - } - } - return true; - } - } - } - return false; - } // isValidIANAEncoding(String):boolean - - /** - * Returns true if the encoding name is a valid Java encoding. - * This method does not verify that there is a decoder available - * for this encoding, only that the characters are valid for an - * Java encoding name. - * - * @param javaEncoding The Java encoding name. - */ - public static boolean isValidJavaEncoding(String javaEncoding) { - if (javaEncoding != null) { - int length = javaEncoding.length(); - if (length > 0) { - for (int i = 1; i < length; i++) { - char c = javaEncoding.charAt(i); - if ((c < 'A' || c > 'Z') && (c < 'a' || c > 'z') && - (c < '0' || c > '9') && c != '.' && c != '_' && - c != '-') { - return false; - } - } - return true; - } - } - return false; - } // isValidIANAEncoding(String):boolean - - -} // class XMLChar diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLEncodingDetector.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLEncodingDetector.java deleted file mode 100644 index a5c8a9308..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLEncodingDetector.java +++ /dev/null @@ -1,1637 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - * ==================================================================== - * - * This software consists of voluntary contributions made by many - * individuals on behalf of the Apache Software Foundation and was - * originally based on software copyright (c) 1999, International - * Business Machines, Inc., http://www.apache.org. For more - * information on the Apache Software Foundation, please see - * . - */ - -package org.apache.jasper.xmlparser; - -import java.io.EOFException; -import java.io.InputStream; -import java.io.InputStreamReader; -import java.io.IOException; -import java.io.Reader; -import java.util.Locale; -import java.util.jar.JarFile; - -import org.apache.jasper.JasperException; -import org.apache.jasper.JspCompilationContext; -import org.apache.jasper.compiler.ErrorDispatcher; -import org.apache.jasper.compiler.JspUtil; - -public class XMLEncodingDetector { - - private InputStream stream; - private String encoding; - private boolean isEncodingSetInProlog; - private boolean isBomPresent; - private int skip; - private Boolean isBigEndian; - private Reader reader; - - // org.apache.xerces.impl.XMLEntityManager fields - public static final int DEFAULT_BUFFER_SIZE = 2048; - public static final int DEFAULT_XMLDECL_BUFFER_SIZE = 64; - private boolean fAllowJavaEncodings; - private SymbolTable fSymbolTable; - private XMLEncodingDetector fCurrentEntity; - private int fBufferSize = DEFAULT_BUFFER_SIZE; - - // org.apache.xerces.impl.XMLEntityManager.ScannedEntity fields - private int lineNumber = 1; - private int columnNumber = 1; - private boolean literal; - private char[] ch = new char[DEFAULT_BUFFER_SIZE]; - private int position; - private int count; - private boolean mayReadChunks = false; - - // org.apache.xerces.impl.XMLScanner fields - private XMLString fString = new XMLString(); - private XMLStringBuffer fStringBuffer = new XMLStringBuffer(); - private XMLStringBuffer fStringBuffer2 = new XMLStringBuffer(); - private final static String fVersionSymbol = "version"; - private final static String fEncodingSymbol = "encoding"; - private final static String fStandaloneSymbol = "standalone"; - - // org.apache.xerces.impl.XMLDocumentFragmentScannerImpl fields - private int fMarkupDepth = 0; - private String[] fStrings = new String[3]; - - private ErrorDispatcher err; - - /** - * Constructor - */ - public XMLEncodingDetector() { - fSymbolTable = new SymbolTable(); - fCurrentEntity = this; - } - - /** - * Autodetects the encoding of the XML document supplied by the given - * input stream. - * - * Encoding autodetection is done according to the XML 1.0 specification, - * Appendix F.1: Detection Without External Encoding Information. - * - * @return Two-element array, where the first element (of type - * java.lang.String) contains the name of the (auto)detected encoding, and - * the second element (of type java.lang.Boolean) specifies whether the - * encoding was specified using the 'encoding' attribute of an XML prolog - * (TRUE) or autodetected (FALSE). - */ - public static Object[] getEncoding(String fname, JarFile jarFile, - JspCompilationContext ctxt, - ErrorDispatcher err) - throws IOException, JasperException - { - InputStream inStream = JspUtil.getInputStream(fname, jarFile, ctxt, - err); - XMLEncodingDetector detector = new XMLEncodingDetector(); - Object[] ret = detector.getEncoding(inStream, err); - inStream.close(); - - return ret; - } - - private Object[] getEncoding(InputStream in, ErrorDispatcher err) - throws IOException, JasperException - { - this.stream = in; - this.err=err; - createInitialReader(); - scanXMLDecl(); - - return new Object[] { this.encoding, - Boolean.valueOf(this.isEncodingSetInProlog), - Boolean.valueOf(this.isBomPresent), - Integer.valueOf(this.skip) }; - } - - // stub method - void endEntity() { - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.startEntity() - private void createInitialReader() throws IOException, JasperException { - - // wrap this stream in RewindableInputStream - stream = new RewindableInputStream(stream); - - // perform auto-detect of encoding if necessary - if (encoding == null) { - // read first four bytes and determine encoding - final byte[] b4 = new byte[4]; - int count = 0; - for (; count<4; count++ ) { - b4[count] = (byte)stream.read(); - } - if (count == 4) { - Object [] encodingDesc = getEncodingName(b4, count); - encoding = (String)(encodingDesc[0]); - isBigEndian = (Boolean)(encodingDesc[1]); - - if (encodingDesc.length > 3) { - isBomPresent = (Boolean)(encodingDesc[2]); - skip = (Integer)(encodingDesc[3]); - } else { - isBomPresent = true; - skip = (Integer)(encodingDesc[2]); - } - - stream.reset(); - // Special case UTF-8 files with BOM created by Microsoft - // tools. It's more efficient to consume the BOM than make - // the reader perform extra checks. -Ac - if (count > 2 && encoding.equals("UTF-8")) { - int b0 = b4[0] & 0xFF; - int b1 = b4[1] & 0xFF; - int b2 = b4[2] & 0xFF; - if (b0 == 0xEF && b1 == 0xBB && b2 == 0xBF) { - // ignore first three bytes... - stream.skip(3); - } - } - reader = createReader(stream, encoding, isBigEndian); - } else { - reader = createReader(stream, encoding, isBigEndian); - } - } - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.createReader - /** - * Creates a reader capable of reading the given input stream in - * the specified encoding. - * - * @param inputStream The input stream. - * @param encoding The encoding name that the input stream is - * encoded using. If the user has specified that - * Java encoding names are allowed, then the - * encoding name may be a Java encoding name; - * otherwise, it is an ianaEncoding name. - * @param isBigEndian For encodings (like uCS-4), whose names cannot - * specify a byte order, this tells whether the order - * is bigEndian. null means unknown or not relevant. - * - * @return Returns a reader. - */ - private Reader createReader(InputStream inputStream, String encoding, - Boolean isBigEndian) - throws IOException, JasperException { - - // normalize encoding name - if (encoding == null) { - encoding = "UTF-8"; - } - - // try to use an optimized reader - String ENCODING = encoding.toUpperCase(Locale.ENGLISH); - if (ENCODING.equals("UTF-8")) { - return new UTF8Reader(inputStream, fBufferSize); - } - if (ENCODING.equals("US-ASCII")) { - return new ASCIIReader(inputStream, fBufferSize); - } - if (ENCODING.equals("ISO-10646-UCS-4")) { - if (isBigEndian != null) { - boolean isBE = isBigEndian.booleanValue(); - if (isBE) { - return new UCSReader(inputStream, UCSReader.UCS4BE); - } else { - return new UCSReader(inputStream, UCSReader.UCS4LE); - } - } else { - err.jspError("jsp.error.xml.encodingByteOrderUnsupported", - encoding); - } - } - if (ENCODING.equals("ISO-10646-UCS-2")) { - if (isBigEndian != null) { // sould never happen with this encoding... - boolean isBE = isBigEndian.booleanValue(); - if (isBE) { - return new UCSReader(inputStream, UCSReader.UCS2BE); - } else { - return new UCSReader(inputStream, UCSReader.UCS2LE); - } - } else { - err.jspError("jsp.error.xml.encodingByteOrderUnsupported", - encoding); - } - } - - // check for valid name - boolean validIANA = XMLChar.isValidIANAEncoding(encoding); - boolean validJava = XMLChar.isValidJavaEncoding(encoding); - if (!validIANA || (fAllowJavaEncodings && !validJava)) { - err.jspError("jsp.error.xml.encodingDeclInvalid", encoding); - // NOTE: AndyH suggested that, on failure, we use ISO Latin 1 - // because every byte is a valid ISO Latin 1 character. - // It may not translate correctly but if we failed on - // the encoding anyway, then we're expecting the content - // of the document to be bad. This will just prevent an - // invalid UTF-8 sequence to be detected. This is only - // important when continue-after-fatal-error is turned - // on. -Ac - encoding = "ISO-8859-1"; - } - - // try to use a Java reader - String javaEncoding = EncodingMap.getIANA2JavaMapping(ENCODING); - if (javaEncoding == null) { - if (fAllowJavaEncodings) { - javaEncoding = encoding; - } else { - err.jspError("jsp.error.xml.encodingDeclInvalid", encoding); - // see comment above. - javaEncoding = "ISO8859_1"; - } - } - return new InputStreamReader(inputStream, javaEncoding); - - } // createReader(InputStream,String, Boolean): Reader - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.getEncodingName - /** - * Returns the IANA encoding name that is auto-detected from - * the bytes specified, with the endian-ness of that encoding where - * appropriate. - * - * @param b4 The first four bytes of the input. - * @param count The number of bytes actually read. - * @return a 2-element array: the first element, an IANA-encoding string, - * the second element a Boolean which is true iff the document is big - * endian, false if it's little-endian, and null if the distinction isn't - * relevant. - */ - private Object[] getEncodingName(byte[] b4, int count) { - - if (count < 2) { - return new Object[]{"UTF-8", null, Boolean.FALSE, Integer.valueOf(0)}; - } - - // UTF-16, with BOM - int b0 = b4[0] & 0xFF; - int b1 = b4[1] & 0xFF; - if (b0 == 0xFE && b1 == 0xFF) { - // UTF-16, big-endian - return new Object [] {"UTF-16BE", Boolean.TRUE, Integer.valueOf(2)}; - } - if (b0 == 0xFF && b1 == 0xFE) { - // UTF-16, little-endian - return new Object [] {"UTF-16LE", Boolean.FALSE, Integer.valueOf(2)}; - } - - // default to UTF-8 if we don't have enough bytes to make a - // good determination of the encoding - if (count < 3) { - return new Object [] {"UTF-8", null, Boolean.FALSE, Integer.valueOf(0)}; - } - - // UTF-8 with a BOM - int b2 = b4[2] & 0xFF; - if (b0 == 0xEF && b1 == 0xBB && b2 == 0xBF) { - return new Object [] {"UTF-8", null, Integer.valueOf(3)}; - } - - // default to UTF-8 if we don't have enough bytes to make a - // good determination of the encoding - if (count < 4) { - return new Object [] {"UTF-8", null, Integer.valueOf(0)}; - } - - // other encodings - int b3 = b4[3] & 0xFF; - if (b0 == 0x00 && b1 == 0x00 && b2 == 0x00 && b3 == 0x3C) { - // UCS-4, big endian (1234) - return new Object [] {"ISO-10646-UCS-4", new Boolean(true), Integer.valueOf(4)}; - } - if (b0 == 0x3C && b1 == 0x00 && b2 == 0x00 && b3 == 0x00) { - // UCS-4, little endian (4321) - return new Object [] {"ISO-10646-UCS-4", new Boolean(false), Integer.valueOf(4)}; - } - if (b0 == 0x00 && b1 == 0x00 && b2 == 0x3C && b3 == 0x00) { - // UCS-4, unusual octet order (2143) - // REVISIT: What should this be? - return new Object [] {"ISO-10646-UCS-4", null, Integer.valueOf(4)}; - } - if (b0 == 0x00 && b1 == 0x3C && b2 == 0x00 && b3 == 0x00) { - // UCS-4, unusual octect order (3412) - // REVISIT: What should this be? - return new Object [] {"ISO-10646-UCS-4", null, Integer.valueOf(4)}; - } - if (b0 == 0x00 && b1 == 0x3C && b2 == 0x00 && b3 == 0x3F) { - // UTF-16, big-endian, no BOM - // (or could turn out to be UCS-2... - // REVISIT: What should this be? - return new Object [] {"UTF-16BE", new Boolean(true), Integer.valueOf(4)}; - } - if (b0 == 0x3C && b1 == 0x00 && b2 == 0x3F && b3 == 0x00) { - // UTF-16, little-endian, no BOM - // (or could turn out to be UCS-2... - return new Object [] {"UTF-16LE", new Boolean(false), Integer.valueOf(4)}; - } - if (b0 == 0x4C && b1 == 0x6F && b2 == 0xA7 && b3 == 0x94) { - // EBCDIC - // a la xerces1, return CP037 instead of EBCDIC here - return new Object [] {"CP037", null, Integer.valueOf(4)}; - } - - // default encoding - return new Object [] {"UTF-8", null, Boolean.FALSE, Integer.valueOf(0)}; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.isExternal - /** Returns true if the current entity being scanned is external. */ - public boolean isExternal() { - return true; - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.peekChar - /** - * Returns the next character on the input. - *

- * Note: The character is not consumed. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - */ - public int peekChar() throws IOException { - - // load more characters, if needed - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - - // peek at character - int c = fCurrentEntity.ch[fCurrentEntity.position]; - - // return peeked character - if (fCurrentEntity.isExternal()) { - return c != '\r' ? c : '\n'; - } - else { - return c; - } - - } // peekChar():int - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.scanChar - /** - * Returns the next character on the input. - *

- * Note: The character is consumed. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - */ - public int scanChar() throws IOException { - - // load more characters, if needed - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - - // scan character - int c = fCurrentEntity.ch[fCurrentEntity.position++]; - boolean external = false; - if (c == '\n' || - (c == '\r' && (external = fCurrentEntity.isExternal()))) { - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - if (fCurrentEntity.position == fCurrentEntity.count) { - fCurrentEntity.ch[0] = (char)c; - load(1, false); - } - if (c == '\r' && external) { - if (fCurrentEntity.ch[fCurrentEntity.position++] != '\n') { - fCurrentEntity.position--; - } - c = '\n'; - } - } - - // return character that was scanned - fCurrentEntity.columnNumber++; - return c; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.scanName - /** - * Returns a string matching the Name production appearing immediately - * on the input as a symbol, or null if no Name string is present. - *

- * Note: The Name characters are consumed. - *

- * Note: The string returned must be a symbol. The - * SymbolTable can be used for this purpose. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - * - * @see SymbolTable - * @see XMLChar#isName - * @see XMLChar#isNameStart - */ - public String scanName() throws IOException { - - // load more characters, if needed - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - - // scan name - int offset = fCurrentEntity.position; - if (XMLChar.isNameStart(fCurrentEntity.ch[offset])) { - if (++fCurrentEntity.position == fCurrentEntity.count) { - fCurrentEntity.ch[0] = fCurrentEntity.ch[offset]; - offset = 0; - if (load(1, false)) { - fCurrentEntity.columnNumber++; - String symbol = fSymbolTable.addSymbol(fCurrentEntity.ch, - 0, 1); - return symbol; - } - } - while (XMLChar.isName(fCurrentEntity.ch[fCurrentEntity.position])) { - if (++fCurrentEntity.position == fCurrentEntity.count) { - int length = fCurrentEntity.position - offset; - if (length == fBufferSize) { - // bad luck we have to resize our buffer - char[] tmp = new char[fBufferSize * 2]; - System.arraycopy(fCurrentEntity.ch, offset, - tmp, 0, length); - fCurrentEntity.ch = tmp; - fBufferSize *= 2; - } else { - System.arraycopy(fCurrentEntity.ch, offset, - fCurrentEntity.ch, 0, length); - } - offset = 0; - if (load(length, false)) { - break; - } - } - } - } - int length = fCurrentEntity.position - offset; - fCurrentEntity.columnNumber += length; - - // return name - String symbol = null; - if (length > 0) { - symbol = fSymbolTable.addSymbol(fCurrentEntity.ch, offset, length); - } - return symbol; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.scanLiteral - /** - * Scans a range of attribute value data, setting the fields of the - * XMLString structure, appropriately. - *

- * Note: The characters are consumed. - *

- * Note: This method does not guarantee to return - * the longest run of attribute value data. This method may return - * before the quote character due to reaching the end of the input - * buffer or any other reason. - *

- * Note: The fields contained in the XMLString - * structure are not guaranteed to remain valid upon subsequent calls - * to the entity scanner. Therefore, the caller is responsible for - * immediately using the returned character data or making a copy of - * the character data. - * - * @param quote The quote character that signifies the end of the - * attribute value data. - * @param content The content structure to fill. - * - * @return Returns the next character on the input, if known. This - * value may be -1 but this does note designate - * end of file. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - */ - public int scanLiteral(int quote, XMLString content) - throws IOException { - - // load more characters, if needed - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } else if (fCurrentEntity.position == fCurrentEntity.count - 1) { - fCurrentEntity.ch[0] = fCurrentEntity.ch[fCurrentEntity.count - 1]; - load(1, false); - fCurrentEntity.position = 0; - } - - // normalize newlines - int offset = fCurrentEntity.position; - int c = fCurrentEntity.ch[offset]; - int newlines = 0; - boolean external = fCurrentEntity.isExternal(); - if (c == '\n' || (c == '\r' && external)) { - do { - c = fCurrentEntity.ch[fCurrentEntity.position++]; - if (c == '\r' && external) { - newlines++; - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - if (fCurrentEntity.position == fCurrentEntity.count) { - offset = 0; - fCurrentEntity.position = newlines; - if (load(newlines, false)) { - break; - } - } - if (fCurrentEntity.ch[fCurrentEntity.position] == '\n') { - fCurrentEntity.position++; - offset++; - } - /*** NEWLINE NORMALIZATION ***/ - else { - newlines++; - } - /***/ - } - else if (c == '\n') { - newlines++; - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - if (fCurrentEntity.position == fCurrentEntity.count) { - offset = 0; - fCurrentEntity.position = newlines; - if (load(newlines, false)) { - break; - } - } - /*** NEWLINE NORMALIZATION *** - if (fCurrentEntity.ch[fCurrentEntity.position] == '\r' - && external) { - fCurrentEntity.position++; - offset++; - } - /***/ - } - else { - fCurrentEntity.position--; - break; - } - } while (fCurrentEntity.position < fCurrentEntity.count - 1); - for (int i = offset; i < fCurrentEntity.position; i++) { - fCurrentEntity.ch[i] = '\n'; - } - int length = fCurrentEntity.position - offset; - if (fCurrentEntity.position == fCurrentEntity.count - 1) { - content.setValues(fCurrentEntity.ch, offset, length); - return -1; - } - } - - // scan literal value - while (fCurrentEntity.position < fCurrentEntity.count) { - c = fCurrentEntity.ch[fCurrentEntity.position++]; - if ((c == quote && - (!fCurrentEntity.literal || external)) - || c == '%' || !XMLChar.isContent(c)) { - fCurrentEntity.position--; - break; - } - } - int length = fCurrentEntity.position - offset; - fCurrentEntity.columnNumber += length - newlines; - content.setValues(fCurrentEntity.ch, offset, length); - - // return next character - if (fCurrentEntity.position != fCurrentEntity.count) { - c = fCurrentEntity.ch[fCurrentEntity.position]; - // NOTE: We don't want to accidentally signal the - // end of the literal if we're expanding an - // entity appearing in the literal. -Ac - if (c == quote && fCurrentEntity.literal) { - c = -1; - } - } - else { - c = -1; - } - return c; - - } - - /** - * Scans a range of character data up to the specified delimiter, - * setting the fields of the XMLString structure, appropriately. - *

- * Note: The characters are consumed. - *

- * Note: This assumes that the internal buffer is - * at least the same size, or bigger, than the length of the delimiter - * and that the delimiter contains at least one character. - *

- * Note: This method does not guarantee to return - * the longest run of character data. This method may return before - * the delimiter due to reaching the end of the input buffer or any - * other reason. - *

- * Note: The fields contained in the XMLString - * structure are not guaranteed to remain valid upon subsequent calls - * to the entity scanner. Therefore, the caller is responsible for - * immediately using the returned character data or making a copy of - * the character data. - * - * @param delimiter The string that signifies the end of the character - * data to be scanned. - * @param buffer The data structure to fill. - * - * @return Returns true if there is more data to scan, false otherwise. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - */ - public boolean scanData(String delimiter, XMLStringBuffer buffer) - throws IOException { - - boolean done = false; - int delimLen = delimiter.length(); - char charAt0 = delimiter.charAt(0); - boolean external = fCurrentEntity.isExternal(); - do { - - // load more characters, if needed - - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - else if (fCurrentEntity.position >= fCurrentEntity.count - delimLen) { - System.arraycopy(fCurrentEntity.ch, fCurrentEntity.position, - fCurrentEntity.ch, 0, fCurrentEntity.count - fCurrentEntity.position); - load(fCurrentEntity.count - fCurrentEntity.position, false); - fCurrentEntity.position = 0; - } - if (fCurrentEntity.position >= fCurrentEntity.count - delimLen) { - // something must be wrong with the input: e.g., file ends an - // unterminated comment - int length = fCurrentEntity.count - fCurrentEntity.position; - buffer.append (fCurrentEntity.ch, fCurrentEntity.position, - length); - fCurrentEntity.columnNumber += fCurrentEntity.count; - fCurrentEntity.position = fCurrentEntity.count; - load(0,true); - return false; - } - - // normalize newlines - int offset = fCurrentEntity.position; - int c = fCurrentEntity.ch[offset]; - int newlines = 0; - if (c == '\n' || (c == '\r' && external)) { - do { - c = fCurrentEntity.ch[fCurrentEntity.position++]; - if (c == '\r' && external) { - newlines++; - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - if (fCurrentEntity.position == fCurrentEntity.count) { - offset = 0; - fCurrentEntity.position = newlines; - if (load(newlines, false)) { - break; - } - } - if (fCurrentEntity.ch[fCurrentEntity.position] == '\n') { - fCurrentEntity.position++; - offset++; - } - /*** NEWLINE NORMALIZATION ***/ - else { - newlines++; - } - } - else if (c == '\n') { - newlines++; - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - if (fCurrentEntity.position == fCurrentEntity.count) { - offset = 0; - fCurrentEntity.position = newlines; - fCurrentEntity.count = newlines; - if (load(newlines, false)) { - break; - } - } - } - else { - fCurrentEntity.position--; - break; - } - } while (fCurrentEntity.position < fCurrentEntity.count - 1); - for (int i = offset; i < fCurrentEntity.position; i++) { - fCurrentEntity.ch[i] = '\n'; - } - int length = fCurrentEntity.position - offset; - if (fCurrentEntity.position == fCurrentEntity.count - 1) { - buffer.append(fCurrentEntity.ch, offset, length); - return true; - } - } - - // iterate over buffer looking for delimiter - OUTER: while (fCurrentEntity.position < fCurrentEntity.count) { - c = fCurrentEntity.ch[fCurrentEntity.position++]; - if (c == charAt0) { - // looks like we just hit the delimiter - int delimOffset = fCurrentEntity.position - 1; - for (int i = 1; i < delimLen; i++) { - if (fCurrentEntity.position == fCurrentEntity.count) { - fCurrentEntity.position -= i; - break OUTER; - } - c = fCurrentEntity.ch[fCurrentEntity.position++]; - if (delimiter.charAt(i) != c) { - fCurrentEntity.position--; - break; - } - } - if (fCurrentEntity.position == delimOffset + delimLen) { - done = true; - break; - } - } - else if (c == '\n' || (external && c == '\r')) { - fCurrentEntity.position--; - break; - } - else if (XMLChar.isInvalid(c)) { - fCurrentEntity.position--; - int length = fCurrentEntity.position - offset; - fCurrentEntity.columnNumber += length - newlines; - buffer.append(fCurrentEntity.ch, offset, length); - return true; - } - } - int length = fCurrentEntity.position - offset; - fCurrentEntity.columnNumber += length - newlines; - if (done) { - length -= delimLen; - } - buffer.append (fCurrentEntity.ch, offset, length); - - // return true if string was skipped - } while (!done); - return !done; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.skipChar - /** - * Skips a character appearing immediately on the input. - *

- * Note: The character is consumed only if it matches - * the specified character. - * - * @param c The character to skip. - * - * @return Returns true if the character was skipped. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - */ - public boolean skipChar(int c) throws IOException { - - // load more characters, if needed - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - - // skip character - int cc = fCurrentEntity.ch[fCurrentEntity.position]; - if (cc == c) { - fCurrentEntity.position++; - if (c == '\n') { - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - } - else { - fCurrentEntity.columnNumber++; - } - return true; - } else if (c == '\n' && cc == '\r' && fCurrentEntity.isExternal()) { - // handle newlines - if (fCurrentEntity.position == fCurrentEntity.count) { - fCurrentEntity.ch[0] = (char)cc; - load(1, false); - } - fCurrentEntity.position++; - if (fCurrentEntity.ch[fCurrentEntity.position] == '\n') { - fCurrentEntity.position++; - } - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - return true; - } - - // character was not skipped - return false; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.skipSpaces - /** - * Skips space characters appearing immediately on the input. - *

- * Note: The characters are consumed only if they are - * space characters. - * - * @return Returns true if at least one space character was skipped. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - * - * @see XMLChar#isSpace - */ - public boolean skipSpaces() throws IOException { - - // load more characters, if needed - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - - // skip spaces - int c = fCurrentEntity.ch[fCurrentEntity.position]; - if (XMLChar.isSpace(c)) { - boolean external = fCurrentEntity.isExternal(); - do { - boolean entityChanged = false; - // handle newlines - if (c == '\n' || (external && c == '\r')) { - fCurrentEntity.lineNumber++; - fCurrentEntity.columnNumber = 1; - if (fCurrentEntity.position == fCurrentEntity.count - 1) { - fCurrentEntity.ch[0] = (char)c; - entityChanged = load(1, true); - if (!entityChanged) - // the load change the position to be 1, - // need to restore it when entity not changed - fCurrentEntity.position = 0; - } - if (c == '\r' && external) { - // REVISIT: Does this need to be updated to fix the - // #x0D ^#x0A newline normalization problem? -Ac - if (fCurrentEntity.ch[++fCurrentEntity.position] != '\n') { - fCurrentEntity.position--; - } - } - /*** NEWLINE NORMALIZATION *** - else { - if (fCurrentEntity.ch[fCurrentEntity.position + 1] == '\r' - && external) { - fCurrentEntity.position++; - } - } - /***/ - } - else { - fCurrentEntity.columnNumber++; - } - // load more characters, if needed - if (!entityChanged) - fCurrentEntity.position++; - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - } while (XMLChar.isSpace(c = fCurrentEntity.ch[fCurrentEntity.position])); - return true; - } - - // no spaces were found - return false; - - } - - /** - * Skips the specified string appearing immediately on the input. - *

- * Note: The characters are consumed only if they are - * space characters. - * - * @param s The string to skip. - * - * @return Returns true if the string was skipped. - * - * @throws IOException Thrown if i/o error occurs. - * @throws EOFException Thrown on end of file. - */ - public boolean skipString(String s) throws IOException { - - // load more characters, if needed - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, true); - } - - // skip string - final int length = s.length(); - for (int i = 0; i < length; i++) { - char c = fCurrentEntity.ch[fCurrentEntity.position++]; - if (c != s.charAt(i)) { - fCurrentEntity.position -= i + 1; - return false; - } - if (i < length - 1 && fCurrentEntity.position == fCurrentEntity.count) { - System.arraycopy(fCurrentEntity.ch, fCurrentEntity.count - i - 1, fCurrentEntity.ch, 0, i + 1); - // REVISIT: Can a string to be skipped cross an - // entity boundary? -Ac - if (load(i + 1, false)) { - fCurrentEntity.position -= i + 1; - return false; - } - } - } - fCurrentEntity.columnNumber += length; - return true; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.EntityScanner.load - /** - * Loads a chunk of text. - * - * @param offset The offset into the character buffer to - * read the next batch of characters. - * @param changeEntity True if the load should change entities - * at the end of the entity, otherwise leave - * the current entity in place and the entity - * boundary will be signaled by the return - * value. - * - * @returns Returns true if the entity changed as a result of this - * load operation. - */ - final boolean load(int offset, boolean changeEntity) - throws IOException { - - // read characters - int length = fCurrentEntity.mayReadChunks? - (fCurrentEntity.ch.length - offset): - (DEFAULT_XMLDECL_BUFFER_SIZE); - int count = fCurrentEntity.reader.read(fCurrentEntity.ch, offset, - length); - - // reset count and position - boolean entityChanged = false; - if (count != -1) { - if (count != 0) { - fCurrentEntity.count = count + offset; - fCurrentEntity.position = offset; - } - } - - // end of this entity - else { - fCurrentEntity.count = offset; - fCurrentEntity.position = offset; - entityChanged = true; - if (changeEntity) { - endEntity(); - if (fCurrentEntity == null) { - throw new EOFException(); - } - // handle the trailing edges - if (fCurrentEntity.position == fCurrentEntity.count) { - load(0, false); - } - } - } - - return entityChanged; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLEntityManager.RewindableInputStream - /** - * This class wraps the byte inputstreams we're presented with. - * We need it because java.io.InputStreams don't provide - * functionality to reread processed bytes, and they have a habit - * of reading more than one character when you call their read() - * methods. This means that, once we discover the true (declared) - * encoding of a document, we can neither backtrack to read the - * whole doc again nor start reading where we are with a new - * reader. - * - * This class allows rewinding an inputStream by allowing a mark - * to be set, and the stream reset to that position. The - * class assumes that it needs to read one character per - * invocation when it's read() method is inovked, but uses the - * underlying InputStream's read(char[], offset length) method--it - * won't buffer data read this way! - * - * @author Neil Graham, IBM - * @author Glenn Marcy, IBM - */ - private final class RewindableInputStream extends InputStream { - - private InputStream fInputStream; - private byte[] fData; - private int fStartOffset; - private int fEndOffset; - private int fOffset; - private int fLength; - private int fMark; - - public RewindableInputStream(InputStream is) { - fData = new byte[DEFAULT_XMLDECL_BUFFER_SIZE]; - fInputStream = is; - fStartOffset = 0; - fEndOffset = -1; - fOffset = 0; - fLength = 0; - fMark = 0; - } - - public void setStartOffset(int offset) { - fStartOffset = offset; - } - - public void rewind() { - fOffset = fStartOffset; - } - - public int read() throws IOException { - int b = 0; - if (fOffset < fLength) { - return fData[fOffset++] & 0xff; - } - if (fOffset == fEndOffset) { - return -1; - } - if (fOffset == fData.length) { - byte[] newData = new byte[fOffset << 1]; - System.arraycopy(fData, 0, newData, 0, fOffset); - fData = newData; - } - b = fInputStream.read(); - if (b == -1) { - fEndOffset = fOffset; - return -1; - } - fData[fLength++] = (byte)b; - fOffset++; - return b & 0xff; - } - - public int read(byte[] b, int off, int len) throws IOException { - int bytesLeft = fLength - fOffset; - if (bytesLeft == 0) { - if (fOffset == fEndOffset) { - return -1; - } - // better get some more for the voracious reader... - if (fCurrentEntity.mayReadChunks) { - return fInputStream.read(b, off, len); - } - int returnedVal = read(); - if (returnedVal == -1) { - fEndOffset = fOffset; - return -1; - } - b[off] = (byte)returnedVal; - return 1; - } - if (len < bytesLeft) { - if (len <= 0) { - return 0; - } - } - else { - len = bytesLeft; - } - if (b != null) { - System.arraycopy(fData, fOffset, b, off, len); - } - fOffset += len; - return len; - } - - public long skip(long n) - throws IOException - { - int bytesLeft; - if (n <= 0) { - return 0; - } - bytesLeft = fLength - fOffset; - if (bytesLeft == 0) { - if (fOffset == fEndOffset) { - return 0; - } - return fInputStream.skip(n); - } - if (n <= bytesLeft) { - fOffset += n; - return n; - } - fOffset += bytesLeft; - if (fOffset == fEndOffset) { - return bytesLeft; - } - n -= bytesLeft; - /* - * In a manner of speaking, when this class isn't permitting more - * than one byte at a time to be read, it is "blocking". The - * available() method should indicate how much can be read without - * blocking, so while we're in this mode, it should only indicate - * that bytes in its buffer are available; otherwise, the result of - * available() on the underlying InputStream is appropriate. - */ - return fInputStream.skip(n) + bytesLeft; - } - - public int available() throws IOException { - int bytesLeft = fLength - fOffset; - if (bytesLeft == 0) { - if (fOffset == fEndOffset) { - return -1; - } - return fCurrentEntity.mayReadChunks ? fInputStream.available() - : 0; - } - return bytesLeft; - } - - public void mark(int howMuch) { - fMark = fOffset; - } - - public void reset() { - fOffset = fMark; - } - - public boolean markSupported() { - return true; - } - - public void close() throws IOException { - if (fInputStream != null) { - fInputStream.close(); - fInputStream = null; - } - } - } // end of RewindableInputStream class - - // Adapted from: - // org.apache.xerces.impl.XMLDocumentScannerImpl.dispatch - private void scanXMLDecl() throws IOException, JasperException { - - if (skipString(" - * 

-     * [23] XMLDecl ::= '<?xml' VersionInfo EncodingDecl? SDDecl? S? '?>'
-     * [24] VersionInfo ::= S 'version' Eq (' VersionNum ' | " VersionNum ")
-     * [80] EncodingDecl ::= S 'encoding' Eq ('"' EncName '"' |  "'" EncName "'" )
-     * [81] EncName ::= [A-Za-z] ([A-Za-z0-9._] | '-')*
-     * [32] SDDecl ::= S 'standalone' Eq (("'" ('yes' | 'no') "'")
-     *                 | ('"' ('yes' | 'no') '"'))
-     *
-     * [77] TextDecl ::= '<?xml' VersionInfo? EncodingDecl S? '?>'
-     *
- * - * @param scanningTextDecl True if a text declaration is to - * be scanned instead of an XML - * declaration. - */ - private void scanXMLDeclOrTextDecl(boolean scanningTextDecl) - throws IOException, JasperException { - - // scan decl - scanXMLDeclOrTextDecl(scanningTextDecl, fStrings); - fMarkupDepth--; - - // pseudo-attribute values - String encodingPseudoAttr = fStrings[1]; - - // set encoding on reader - if (encodingPseudoAttr != null) { - isEncodingSetInProlog = true; - encoding = encodingPseudoAttr; - } - } - - // Adapted from: - // org.apache.xerces.impl.XMLScanner.scanXMLDeclOrTextDecl - /** - * Scans an XML or text declaration. - *

- * 

-     * [23] XMLDecl ::= ''
-     * [24] VersionInfo ::= S 'version' Eq (' VersionNum ' | " VersionNum ")
-     * [80] EncodingDecl ::= S 'encoding' Eq ('"' EncName '"' |  "'" EncName "'" )
-     * [81] EncName ::= [A-Za-z] ([A-Za-z0-9._] | '-')*
-     * [32] SDDecl ::= S 'standalone' Eq (("'" ('yes' | 'no') "'")
-     *                 | ('"' ('yes' | 'no') '"'))
-     *
-     * [77] TextDecl ::= ''
-     *
- * - * @param scanningTextDecl True if a text declaration is to - * be scanned instead of an XML - * declaration. - * @param pseudoAttributeValues An array of size 3 to return the version, - * encoding and standalone pseudo attribute values - * (in that order). - * - * Note: This method uses fString, anything in it - * at the time of calling is lost. - */ - private void scanXMLDeclOrTextDecl(boolean scanningTextDecl, - String[] pseudoAttributeValues) - throws IOException, JasperException { - - // pseudo-attribute values - String version = null; - String encoding = null; - String standalone = null; - - // scan pseudo-attributes - final int STATE_VERSION = 0; - final int STATE_ENCODING = 1; - final int STATE_STANDALONE = 2; - final int STATE_DONE = 3; - int state = STATE_VERSION; - - boolean dataFoundForTarget = false; - boolean sawSpace = skipSpaces(); - while (peekChar() != '?') { - dataFoundForTarget = true; - String name = scanPseudoAttribute(scanningTextDecl, fString); - switch (state) { - case STATE_VERSION: { - if (name == fVersionSymbol) { - if (!sawSpace) { - reportFatalError(scanningTextDecl - ? "jsp.error.xml.spaceRequiredBeforeVersionInTextDecl" - : "jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl", - null); - } - version = fString.toString(); - state = STATE_ENCODING; - if (!version.equals("1.0")) { - // REVISIT: XML REC says we should throw an error - // in such cases. - // some may object the throwing of fatalError. - err.jspError("jsp.error.xml.versionNotSupported", - version); - } - } else if (name == fEncodingSymbol) { - if (!scanningTextDecl) { - err.jspError("jsp.error.xml.versionInfoRequired"); - } - if (!sawSpace) { - reportFatalError(scanningTextDecl - ? "jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl" - : "jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl", - null); - } - encoding = fString.toString(); - state = scanningTextDecl ? STATE_DONE : STATE_STANDALONE; - } else { - if (scanningTextDecl) { - err.jspError("jsp.error.xml.encodingDeclRequired"); - } - else { - err.jspError("jsp.error.xml.versionInfoRequired"); - } - } - break; - } - case STATE_ENCODING: { - if (name == fEncodingSymbol) { - if (!sawSpace) { - reportFatalError(scanningTextDecl - ? "jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl" - : "jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl", - null); - } - encoding = fString.toString(); - state = scanningTextDecl ? STATE_DONE : STATE_STANDALONE; - // TODO: check encoding name; set encoding on - // entity scanner - } else if (!scanningTextDecl && name == fStandaloneSymbol) { - if (!sawSpace) { - err.jspError("jsp.error.xml.spaceRequiredBeforeStandalone"); - } - standalone = fString.toString(); - state = STATE_DONE; - if (!standalone.equals("yes") && !standalone.equals("no")) { - err.jspError("jsp.error.xml.sdDeclInvalid"); - } - } else { - err.jspError("jsp.error.xml.encodingDeclRequired"); - } - break; - } - case STATE_STANDALONE: { - if (name == fStandaloneSymbol) { - if (!sawSpace) { - err.jspError("jsp.error.xml.spaceRequiredBeforeStandalone"); - } - standalone = fString.toString(); - state = STATE_DONE; - if (!standalone.equals("yes") && !standalone.equals("no")) { - err.jspError("jsp.error.xml.sdDeclInvalid"); - } - } else { - err.jspError("jsp.error.xml.encodingDeclRequired"); - } - break; - } - default: { - err.jspError("jsp.error.xml.noMorePseudoAttributes"); - } - } - sawSpace = skipSpaces(); - } - // REVISIT: should we remove this error reporting? - if (scanningTextDecl && state != STATE_DONE) { - err.jspError("jsp.error.xml.morePseudoAttributes"); - } - - // If there is no data in the xml or text decl then we fail to report - // error for version or encoding info above. - if (scanningTextDecl) { - if (!dataFoundForTarget && encoding == null) { - err.jspError("jsp.error.xml.encodingDeclRequired"); - } - } else { - if (!dataFoundForTarget && version == null) { - err.jspError("jsp.error.xml.versionInfoRequired"); - } - } - - // end - if (!skipChar('?')) { - err.jspError("jsp.error.xml.xmlDeclUnterminated"); - } - if (!skipChar('>')) { - err.jspError("jsp.error.xml.xmlDeclUnterminated"); - - } - - // fill in return array - pseudoAttributeValues[0] = version; - pseudoAttributeValues[1] = encoding; - pseudoAttributeValues[2] = standalone; - } - - // Adapted from: - // org.apache.xerces.impl.XMLScanner.scanPseudoAttribute - /** - * Scans a pseudo attribute. - * - * @param scanningTextDecl True if scanning this pseudo-attribute for a - * TextDecl; false if scanning XMLDecl. This - * flag is needed to report the correct type of - * error. - * @param value The string to fill in with the attribute - * value. - * - * @return The name of the attribute - * - * Note: This method uses fStringBuffer2, anything in it - * at the time of calling is lost. - */ - public String scanPseudoAttribute(boolean scanningTextDecl, - XMLString value) - throws IOException, JasperException { - - String name = scanName(); - if (name == null) { - err.jspError("jsp.error.xml.pseudoAttrNameExpected"); - } - skipSpaces(); - if (!skipChar('=')) { - reportFatalError(scanningTextDecl ? - "jsp.error.xml.eqRequiredInTextDecl" - : "jsp.error.xml.eqRequiredInXMLDecl", - name); - } - skipSpaces(); - int quote = peekChar(); - if (quote != '\'' && quote != '"') { - reportFatalError(scanningTextDecl ? - "jsp.error.xml.quoteRequiredInTextDecl" - : "jsp.error.xml.quoteRequiredInXMLDecl" , - name); - } - scanChar(); - int c = scanLiteral(quote, value); - if (c != quote) { - fStringBuffer2.clear(); - do { - fStringBuffer2.append(value); - if (c != -1) { - if (c == '&' || c == '%' || c == '<' || c == ']') { - fStringBuffer2.append((char)scanChar()); - } - else if (XMLChar.isHighSurrogate(c)) { - scanSurrogates(fStringBuffer2); - } - else if (XMLChar.isInvalid(c)) { - String key = scanningTextDecl - ? "jsp.error.xml.invalidCharInTextDecl" - : "jsp.error.xml.invalidCharInXMLDecl"; - reportFatalError(key, Integer.toString(c, 16)); - scanChar(); - } - } - c = scanLiteral(quote, value); - } while (c != quote); - fStringBuffer2.append(value); - value.setValues(fStringBuffer2); - } - if (!skipChar(quote)) { - reportFatalError(scanningTextDecl ? - "jsp.error.xml.closeQuoteMissingInTextDecl" - : "jsp.error.xml.closeQuoteMissingInXMLDecl", - name); - } - - // return - return name; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLScanner.scanPIData - /** - * Scans a processing data. This is needed to handle the situation - * where a document starts with a processing instruction whose - * target name starts with "xml". (e.g. xmlfoo) - * - * Note: This method uses fStringBuffer, anything in it - * at the time of calling is lost. - * - * @param target The PI target - * @param data The string to fill in with the data - */ - private void scanPIData(String target, XMLString data) - throws IOException, JasperException { - - // check target - if (target.length() == 3) { - char c0 = Character.toLowerCase(target.charAt(0)); - char c1 = Character.toLowerCase(target.charAt(1)); - char c2 = Character.toLowerCase(target.charAt(2)); - if (c0 == 'x' && c1 == 'm' && c2 == 'l') { - err.jspError("jsp.error.xml.reservedPITarget"); - } - } - - // spaces - if (!skipSpaces()) { - if (skipString("?>")) { - // we found the end, there is no data - data.clear(); - return; - } - else { - // if there is data there should be some space - err.jspError("jsp.error.xml.spaceRequiredInPI"); - } - } - - fStringBuffer.clear(); - // data - if (scanData("?>", fStringBuffer)) { - do { - int c = peekChar(); - if (c != -1) { - if (XMLChar.isHighSurrogate(c)) { - scanSurrogates(fStringBuffer); - } else if (XMLChar.isInvalid(c)) { - err.jspError("jsp.error.xml.invalidCharInPI", - Integer.toHexString(c)); - scanChar(); - } - } - } while (scanData("?>", fStringBuffer)); - } - data.setValues(fStringBuffer); - - } - - // Adapted from: - // org.apache.xerces.impl.XMLScanner.scanSurrogates - /** - * Scans surrogates and append them to the specified buffer. - *

- * Note: This assumes the current char has already been - * identified as a high surrogate. - * - * @param buf The StringBuffer to append the read surrogates to. - * @returns True if it succeeded. - */ - private boolean scanSurrogates(XMLStringBuffer buf) - throws IOException, JasperException { - - int high = scanChar(); - int low = peekChar(); - if (!XMLChar.isLowSurrogate(low)) { - err.jspError("jsp.error.xml.invalidCharInContent", - Integer.toString(high, 16)); - return false; - } - scanChar(); - - // convert surrogates to supplemental character - int c = XMLChar.supplemental((char)high, (char)low); - - // supplemental character must be a valid XML character - if (!XMLChar.isValid(c)) { - err.jspError("jsp.error.xml.invalidCharInContent", - Integer.toString(c, 16)); - return false; - } - - // fill in the buffer - buf.append((char)high); - buf.append((char)low); - - return true; - - } - - // Adapted from: - // org.apache.xerces.impl.XMLScanner.reportFatalError - /** - * Convenience function used in all XML scanners. - */ - private void reportFatalError(String msgId, String arg) - throws JasperException { - err.jspError(msgId, arg); - } - -} - - diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLString.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLString.java deleted file mode 100644 index 10dc81a65..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLString.java +++ /dev/null @@ -1,197 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - * ==================================================================== - * - * This software consists of voluntary contributions made by many - * individuals on behalf of the Apache Software Foundation and was - * originally based on software copyright (c) 1999, International - * Business Machines, Inc., http://www.apache.org. For more - * information on the Apache Software Foundation, please see - * . - */ - -package org.apache.jasper.xmlparser; - -/** - * This class is used as a structure to pass text contained in the underlying - * character buffer of the scanner. The offset and length fields allow the - * buffer to be re-used without creating new character arrays. - *

- * Note: Methods that are passed an XMLString structure - * should consider the contents read-only and not make any modifications - * to the contents of the buffer. The method receiving this structure - * should also not modify the offset and length if this structure (or - * the values of this structure) are passed to another method. - *

- * Note: Methods that are passed an XMLString structure - * are required to copy the information out of the buffer if it is to be - * saved for use beyond the scope of the method. The contents of the - * structure are volatile and the contents of the character buffer cannot - * be assured once the method that is passed this structure returns. - * Therefore, methods passed this structure should not save any reference - * to the structure or the character array contained in the structure. - * - * @author Eric Ye, IBM - * @author Andy Clark, IBM - * - * @version $Id: XMLString.java 467222 2006-10-24 03:17:11Z markt $ - */ -public class XMLString { - - // - // Data - // - - /** The character array. */ - public char[] ch; - - /** The offset into the character array. */ - public int offset; - - /** The length of characters from the offset. */ - public int length; - - // - // Constructors - // - - /** Default constructor. */ - public XMLString() { - } // () - - /** - * Constructs an XMLString structure preset with the specified - * values. - * - * @param ch The character array. - * @param offset The offset into the character array. - * @param length The length of characters from the offset. - */ - public XMLString(char[] ch, int offset, int length) { - setValues(ch, offset, length); - } // (char[],int,int) - - /** - * Constructs an XMLString structure with copies of the values in - * the given structure. - *

- * Note: This does not copy the character array; - * only the reference to the array is copied. - * - * @param string The XMLString to copy. - */ - public XMLString(XMLString string) { - setValues(string); - } // (XMLString) - - // - // Public methods - // - - /** - * Initializes the contents of the XMLString structure with the - * specified values. - * - * @param ch The character array. - * @param offset The offset into the character array. - * @param length The length of characters from the offset. - */ - public void setValues(char[] ch, int offset, int length) { - this.ch = ch; - this.offset = offset; - this.length = length; - } // setValues(char[],int,int) - - /** - * Initializes the contents of the XMLString structure with copies - * of the given string structure. - *

- * Note: This does not copy the character array; - * only the reference to the array is copied. - * - * @param s - */ - public void setValues(XMLString s) { - setValues(s.ch, s.offset, s.length); - } // setValues(XMLString) - - /** Resets all of the values to their defaults. */ - public void clear() { - this.ch = null; - this.offset = 0; - this.length = -1; - } // clear() - - /** - * Returns true if the contents of this XMLString structure and - * the specified array are equal. - * - * @param ch The character array. - * @param offset The offset into the character array. - * @param length The length of characters from the offset. - */ - public boolean equals(char[] ch, int offset, int length) { - if (ch == null) { - return false; - } - if (this.length != length) { - return false; - } - - for (int i=0; i 0 ? new String(ch, offset, length) : ""; - } // toString():String - -} // class XMLString diff --git a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLStringBuffer.java b/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLStringBuffer.java deleted file mode 100644 index 93e6ebcfb..000000000 --- a/plugins/embeddedjsp/src/main/java/org/apache/struts2/jasper/xmlparser/XMLStringBuffer.java +++ /dev/null @@ -1,176 +0,0 @@ -/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the "License"); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an "AS IS" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - * ==================================================================== - * - * This software consists of voluntary contributions made by many - * individuals on behalf of the Apache Software Foundation and was - * originally based on software copyright (c) 1999, International - * Business Machines, Inc., http://www.apache.org. For more - * information on the Apache Software Foundation, please see - * . - */ - -package org.apache.jasper.xmlparser; - -/** - * XMLString is a structure used to pass character arrays. However, - * XMLStringBuffer is a buffer in which characters can be appended - * and extends XMLString so that it can be passed to methods - * expecting an XMLString object. This is a safe operation because - * it is assumed that any callee will not modify - * the contents of the XMLString structure. - *

- * The contents of the string are managed by the string buffer. As - * characters are appended, the string buffer will grow as needed. - *

- * Note: Never set the ch, - * offset, and length fields directly. - * These fields are managed by the string buffer. In order to reset - * the buffer, call clear(). - * - * @author Andy Clark, IBM - * @author Eric Ye, IBM - * - * @version $Id: XMLStringBuffer.java 467222 2006-10-24 03:17:11Z markt $ - */ -public class XMLStringBuffer - extends XMLString { - - // - // Constants - // - - /** Default buffer size (32). */ - public static final int DEFAULT_SIZE = 32; - - // - // Constructors - // - - /** - * - */ - public XMLStringBuffer() { - this(DEFAULT_SIZE); - } // () - - /** - * - * - * @param size - */ - public XMLStringBuffer(int size) { - ch = new char[size]; - } // (int) - - /** Constructs a string buffer from a char. */ - public XMLStringBuffer(char c) { - this(1); - append(c); - } // (char) - - /** Constructs a string buffer from a String. */ - public XMLStringBuffer(String s) { - this(s.length()); - append(s); - } // (String) - - /** Constructs a string buffer from the specified character array. */ - public XMLStringBuffer(char[] ch, int offset, int length) { - this(length); - append(ch, offset, length); - } // (char[],int,int) - - /** Constructs a string buffer from the specified XMLString. */ - public XMLStringBuffer(XMLString s) { - this(s.length); - append(s); - } // (XMLString) - - // - // Public methods - // - - /** Clears the string buffer. */ - public void clear() { - offset = 0; - length = 0; - } - - /** - * append - * - * @param c - */ - public void append(char c) { - if (this.length + 1 > this.ch.length) { - int newLength = this.ch.length*2; - if (newLength < this.ch.length + DEFAULT_SIZE) - newLength = this.ch.length + DEFAULT_SIZE; - char[] newch = new char[newLength]; - System.arraycopy(this.ch, 0, newch, 0, this.length); - this.ch = newch; - } - this.ch[this.length] = c; - this.length++; - } // append(char) - - /** - * append - * - * @param s - */ - public void append(String s) { - int length = s.length(); - if (this.length + length > this.ch.length) { - int newLength = this.ch.length*2; - if (newLength < this.length + length + DEFAULT_SIZE) - newLength = this.ch.length + length + DEFAULT_SIZE; - char[] newch = new char[newLength]; - System.arraycopy(this.ch, 0, newch, 0, this.length); - this.ch = newch; - } - s.getChars(0, length, this.ch, this.length); - this.length += length; - } // append(String) - - /** - * append - * - * @param ch - * @param offset - * @param length - */ - public void append(char[] ch, int offset, int length) { - if (this.length + length > this.ch.length) { - char[] newch = new char[this.ch.length + length + DEFAULT_SIZE]; - System.arraycopy(this.ch, 0, newch, 0, this.length); - this.ch = newch; - } - System.arraycopy(ch, offset, this.ch, this.length, length); - this.length += length; - } // append(char[],int,int) - - /** - * append - * - * @param s - */ - public void append(XMLString s) { - append(s.ch, s.offset, s.length); - } // append(XMLString) - -} // class XMLStringBuffer